Dataset Preview
The full dataset viewer is not available (click to read why). Only showing a preview of the rows.
The dataset generation failed
Error code: DatasetGenerationError
Exception: TypeError
Message: Couldn't cast array of type
struct<RING-type 1; atypical Zinc finger: int64, RING-type 2; degenerate Zinc finger: int64, C4-type Zinc finger: int64, PHD-type Zinc finger: int64, C3H1-type Zinc finger: int64, RING-type Zinc finger: int64, GATA-type Zinc finger: int64, C2H2-type Zinc finger: int64, DBF4-type Zinc finger: int64, CR-type Zinc finger: int64, C2H2-type 3; degenerate Zinc finger: int64, BED-type Zinc finger: int64, CCHC-type Zinc finger: int64, MYND-type Zinc finger: int64, DNL-type Zinc finger: int64, Ig-like V-type Immunoglobulin domain: int64, C2H2-type 1; atypical Zinc finger: int64, C2H2-type 2; atypical Zinc finger: int64, Ig-like C2-type Immunoglobulin domain: int64, C2H2-type 2; degenerate Zinc finger: int64, C2H2-type; degenerate Zinc finger: int64, A20-type Zinc finger: int64, AN1-type Zinc finger: int64, 3CxxC-type Zinc finger: int64, SBP-type Zinc finger: int64, CHHC U11-48K-type Zinc finger: int64, CXXC-type Zinc finger: int64, CW-type Zinc finger: int64, Matrin-type Zinc finger: int64, C6H2-type Zinc finger: int64, RING-type; atypical Zinc finger: int64, SIAH-type; degenerate Zinc finger: int64, NR C4-type Zinc finger: int64, C2H2-type 5; degenerate Zinc finger: int64, C2H2-type 1; degenerate Zinc finger: int64, B box-type Zinc finger: int64, RanBP2-type Zinc finger: int64, SWIM-type Zinc finger: int64, ZZ-type Zinc finger: int64, UBP-type; degenerate Zinc finger: int64, C2HC LYAR-type Zinc finger: int64, CHY-type; degenerate Zinc finger: int64, TRAF-type Zinc finger: int64, FYVE-type Zinc finger: int64, C2H2-type 3; atypical Zinc finger: int64, C2H2-type 4; atypical Zinc finger: int64, C2H2-type 11; atypical Zinc finger: int64, Ig-like Immunoglobulin domain: int64, RIP-type Zinc finger: int64, RING-type 1; degenerate Zinc finger: int64, FYVE-type; degenerate Zinc finger: int64, RING-type; degenerate Zinc finger: int64>
to
{'C2H2-type Zinc finger': Value(dtype='int64', id=None), 'C2H2-type; degenerate Zinc finger': Value(dtype='int64', id=None), 'Ig-like V-type Immunoglobulin domain': Value(dtype='int64', id=None), 'RING-type; degenerate Zinc finger': Value(dtype='int64', id=None), 'BED-type Zinc finger': Value(dtype='int64', id=None), 'Ig-like C2-type Immunoglobulin domain': Value(dtype='int64', id=None), 'C5HC2 Zinc finger': Value(dtype='int64', id=None), 'C2H2-type 2; degenerate Zinc finger': Value(dtype='int64', id=None), 'C2H2-type 5; degenerate Zinc finger': Value(dtype='int64', id=None), 'CCHC-type Zinc finger': Value(dtype='int64', id=None), 'RING-type Zinc finger': Value(dtype='int64', id=None), 'C4-type Zinc finger': Value(dtype='int64', id=None), 'GATA-type; atypical Zinc finger': Value(dtype='int64', id=None), 'PHD-type; atypical Zinc finger': Value(dtype='int64', id=None), 'SP-RING-type Zinc finger': Value(dtype='int64', id=None), 'C2H2-type 4; atypical Zinc finger': Value(dtype='int64', id=None), 'C2HC MYST-type Zinc finger': Value(dtype='int64', id=None), 'B box-type; degenerate Zinc finger': Value(dtype='int64', id=None), 'RanBP2-type Zinc finger': Value(dtype='int64', id=None), 'CCHHC-type Zinc finger': Value(dtype='int64', id=None), 'NR C4-type Zinc finger': Value(dtype='int64', id=None), 'UBZ4-type Zinc finger': Value(dtype='int64', id=None), 'Ig-like C1-type Immunoglobulin domain': Value(dtype='int64', id=None), 'TFIIS-type Zinc finger': Value(dtype='int64', id=None), 'FYVE-
...
4', id=None), 'Dof-type Zinc finger': Value(dtype='int64', id=None), 'C2H2-type 11; degenerate Zinc finger': Value(dtype='int64', id=None), 'UBZ3-type Zinc finger': Value(dtype='int64', id=None), 'PHD-type 2; atypical Zinc finger': Value(dtype='int64', id=None), 'Matrin-type Zinc finger': Value(dtype='int64', id=None), 'MYND-type Zinc finger': Value(dtype='int64', id=None), 'FPG-type Zinc finger': Value(dtype='int64', id=None), 'ZF-HD dimerization-type; degenerate Zinc finger': Value(dtype='int64', id=None), 'NF-X1-type Zinc finger': Value(dtype='int64', id=None), 'SWIM-type Zinc finger': Value(dtype='int64', id=None), 'MYND-type; atypical Zinc finger': Value(dtype='int64', id=None), 'RING-type 1; atypical Zinc finger': Value(dtype='int64', id=None), 'RING-type 2; atypical Zinc finger': Value(dtype='int64', id=None), 'TFIIB-type Zinc finger': Value(dtype='int64', id=None), 'SIAH-type Zinc finger': Value(dtype='int64', id=None), 'C2H2-type 10; degenerate Zinc finger': Value(dtype='int64', id=None), 'C2H2-type 14; degenerate Zinc finger': Value(dtype='int64', id=None), 'CXXC-type Zinc finger': Value(dtype='int64', id=None), 'NOB1 Zinc finger': Value(dtype='int64', id=None), 'C2H2 AKAP95-type Zinc finger': Value(dtype='int64', id=None), 'MYND-type; degenerate Zinc finger': Value(dtype='int64', id=None), 'A20-type Zinc finger': Value(dtype='int64', id=None), 'AN1-type Zinc finger': Value(dtype='int64', id=None), 'C2H2-type 11; atypical Zinc finger': Value(dtype='int64', id=None)}
Traceback: Traceback (most recent call last):
File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/builder.py", line 1870, in _prepare_split_single
writer.write_table(table)
File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/arrow_writer.py", line 622, in write_table
pa_table = table_cast(pa_table, self._schema)
File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/table.py", line 2292, in table_cast
return cast_table_to_schema(table, schema)
File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/table.py", line 2245, in cast_table_to_schema
arrays = [
File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/table.py", line 2246, in <listcomp>
cast_array_to_feature(
File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/table.py", line 1795, in wrapper
return pa.chunked_array([func(chunk, *args, **kwargs) for chunk in array.chunks])
File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/table.py", line 1795, in <listcomp>
return pa.chunked_array([func(chunk, *args, **kwargs) for chunk in array.chunks])
File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/table.py", line 2005, in cast_array_to_feature
arrays = [
File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/table.py", line 2006, in <listcomp>
_c(array.field(name) if name in array_fields else null_array, subfeature)
File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/table.py", line 1797, in wrapper
return func(array, *args, **kwargs)
File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/table.py", line 2108, in cast_array_to_feature
raise TypeError(f"Couldn't cast array of type\n{_short_str(array.type)}\nto\n{_short_str(feature)}")
TypeError: Couldn't cast array of type
struct<RING-type 1; atypical Zinc finger: int64, RING-type 2; degenerate Zinc finger: int64, C4-type Zinc finger: int64, PHD-type Zinc finger: int64, C3H1-type Zinc finger: int64, RING-type Zinc finger: int64, GATA-type Zinc finger: int64, C2H2-type Zinc finger: int64, DBF4-type Zinc finger: int64, CR-type Zinc finger: int64, C2H2-type 3; degenerate Zinc finger: int64, BED-type Zinc finger: int64, CCHC-type Zinc finger: int64, MYND-type Zinc finger: int64, DNL-type Zinc finger: int64, Ig-like V-type Immunoglobulin domain: int64, C2H2-type 1; atypical Zinc finger: int64, C2H2-type 2; atypical Zinc finger: int64, Ig-like C2-type Immunoglobulin domain: int64, C2H2-type 2; degenerate Zinc finger: int64, C2H2-type; degenerate Zinc finger: int64, A20-type Zinc finger: int64, AN1-type Zinc finger: int64, 3CxxC-type Zinc finger: int64, SBP-type Zinc finger: int64, CHHC U11-48K-type Zinc finger: int64, CXXC-type Zinc finger: int64, CW-type Zinc finger: int64, Matrin-type Zinc finger: int64, C6H2-type Zinc finger: int64, RING-type; atypical Zinc finger: int64, SIAH-type; degenerate Zinc finger: int64, NR C4-type Zinc finger: int64, C2H2-type 5; degenerate Zinc finger: int64, C2H2-type 1; degenerate Zinc finger: int64, B box-type Zinc finger: int64, RanBP2-type Zinc finger: int64, SWIM-type Zinc finger: int64, ZZ-type Zinc finger: int64, UBP-type; degenerate Zinc finger: int64, C2HC LYAR-type Zinc finger: int64, CHY-type; degenerate Zinc finger: int64, TRAF-type Zinc finger: int64, FYVE-type Zinc finger: int64, C2H2-type 3; atypical Zinc finger: int64, C2H2-type 4; atypical Zinc finger: int64, C2H2-type 11; atypical Zinc finger: int64, Ig-like Immunoglobulin domain: int64, RIP-type Zinc finger: int64, RING-type 1; degenerate Zinc finger: int64, FYVE-type; degenerate Zinc finger: int64, RING-type; degenerate Zinc finger: int64>
to
{'C2H2-type Zinc finger': Value(dtype='int64', id=None), 'C2H2-type; degenerate Zinc finger': Value(dtype='int64', id=None), 'Ig-like V-type Immunoglobulin domain': Value(dtype='int64', id=None), 'RING-type; degenerate Zinc finger': Value(dtype='int64', id=None), 'BED-type Zinc finger': Value(dtype='int64', id=None), 'Ig-like C2-type Immunoglobulin domain': Value(dtype='int64', id=None), 'C5HC2 Zinc finger': Value(dtype='int64', id=None), 'C2H2-type 2; degenerate Zinc finger': Value(dtype='int64', id=None), 'C2H2-type 5; degenerate Zinc finger': Value(dtype='int64', id=None), 'CCHC-type Zinc finger': Value(dtype='int64', id=None), 'RING-type Zinc finger': Value(dtype='int64', id=None), 'C4-type Zinc finger': Value(dtype='int64', id=None), 'GATA-type; atypical Zinc finger': Value(dtype='int64', id=None), 'PHD-type; atypical Zinc finger': Value(dtype='int64', id=None), 'SP-RING-type Zinc finger': Value(dtype='int64', id=None), 'C2H2-type 4; atypical Zinc finger': Value(dtype='int64', id=None), 'C2HC MYST-type Zinc finger': Value(dtype='int64', id=None), 'B box-type; degenerate Zinc finger': Value(dtype='int64', id=None), 'RanBP2-type Zinc finger': Value(dtype='int64', id=None), 'CCHHC-type Zinc finger': Value(dtype='int64', id=None), 'NR C4-type Zinc finger': Value(dtype='int64', id=None), 'UBZ4-type Zinc finger': Value(dtype='int64', id=None), 'Ig-like C1-type Immunoglobulin domain': Value(dtype='int64', id=None), 'TFIIS-type Zinc finger': Value(dtype='int64', id=None), 'FYVE-
...
4', id=None), 'Dof-type Zinc finger': Value(dtype='int64', id=None), 'C2H2-type 11; degenerate Zinc finger': Value(dtype='int64', id=None), 'UBZ3-type Zinc finger': Value(dtype='int64', id=None), 'PHD-type 2; atypical Zinc finger': Value(dtype='int64', id=None), 'Matrin-type Zinc finger': Value(dtype='int64', id=None), 'MYND-type Zinc finger': Value(dtype='int64', id=None), 'FPG-type Zinc finger': Value(dtype='int64', id=None), 'ZF-HD dimerization-type; degenerate Zinc finger': Value(dtype='int64', id=None), 'NF-X1-type Zinc finger': Value(dtype='int64', id=None), 'SWIM-type Zinc finger': Value(dtype='int64', id=None), 'MYND-type; atypical Zinc finger': Value(dtype='int64', id=None), 'RING-type 1; atypical Zinc finger': Value(dtype='int64', id=None), 'RING-type 2; atypical Zinc finger': Value(dtype='int64', id=None), 'TFIIB-type Zinc finger': Value(dtype='int64', id=None), 'SIAH-type Zinc finger': Value(dtype='int64', id=None), 'C2H2-type 10; degenerate Zinc finger': Value(dtype='int64', id=None), 'C2H2-type 14; degenerate Zinc finger': Value(dtype='int64', id=None), 'CXXC-type Zinc finger': Value(dtype='int64', id=None), 'NOB1 Zinc finger': Value(dtype='int64', id=None), 'C2H2 AKAP95-type Zinc finger': Value(dtype='int64', id=None), 'MYND-type; degenerate Zinc finger': Value(dtype='int64', id=None), 'A20-type Zinc finger': Value(dtype='int64', id=None), 'AN1-type Zinc finger': Value(dtype='int64', id=None), 'C2H2-type 11; atypical Zinc finger': Value(dtype='int64', id=None)}
The above exception was the direct cause of the following exception:
Traceback (most recent call last):
File "/src/services/worker/src/worker/job_runners/config/parquet_and_info.py", line 1417, in compute_config_parquet_and_info_response
parquet_operations = convert_to_parquet(builder)
File "/src/services/worker/src/worker/job_runners/config/parquet_and_info.py", line 1049, in convert_to_parquet
builder.download_and_prepare(
File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/builder.py", line 924, in download_and_prepare
self._download_and_prepare(
File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/builder.py", line 1000, in _download_and_prepare
self._prepare_split(split_generator, **prepare_split_kwargs)
File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/builder.py", line 1741, in _prepare_split
for job_id, done, content in self._prepare_split_single(
File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/builder.py", line 1897, in _prepare_split_single
raise DatasetGenerationError("An error occurred while generating the dataset") from e
datasets.exceptions.DatasetGenerationError: An error occurred while generating the datasetNeed help to make the dataset viewer work? Make sure to review how to configure the dataset viewer, and open a discussion for direct support.
primaryAccession string | text string | functionDomainRange list | meta_data dict | sequence dict |
|---|---|---|---|---|
A0A4Z3 | This is Alpha-1,3-galactosyltransferase 2 protein, from Rat, contains 339 amino acids, is membrane-bound, locates in Golgi apparatus. | [] | {
"primaryAccession": "A0A4Z3",
"organism_name": "Rat",
"protein_name": "Alpha-1,3-galactosyltransferase 2",
"length": 339,
"firstPublicDate": "2008-01-15T00:00:00",
"FUNCTION": "Synthesizes the galactose-alpha(1,3)-galactose group on the glycosphingolipid isoglobotrihexosylceramide or isogloboside 3 (iGb3) by catalyzing the transfer of galactose from UDP-Galactose to its acceptor molecule Gal-beta-1,4-Glc-ceramide, Can also catalyze the addition of galactose to iGb3 itself to form polygalactose structures, Synthesis of iGb3 is the initial step in the formation of the isoglobo-series glycolipid pathway and is the precursor to isogloboside 4 (iGb4) and isoForssman glycolipids, Can glycosylate only lipids and not proteins and is solely responsible for initiating the synthesis of isoglobo-series glycosphingolipids",
"SUBCELLULAR LOCATION": "Golgi apparatus",
"SIMILARITY": "Belongs to the glycosyltransferase 6 family",
"domain_description": {
"C2H2-type Zinc finger": null,
"C2H2-type; degenerate Zinc finger": null,
"Ig-like V-type Immunoglobulin domain": null,
"RING-type; degenerate Zinc finger": null,
"BED-type Zinc finger": null,
"Ig-like C2-type Immunoglobulin domain": null,
"C5HC2 Zinc finger": null,
"C2H2-type 2; degenerate Zinc finger": null,
"C2H2-type 5; degenerate Zinc finger": null,
"DBF4-type Zinc finger": null,
"RING-CH-type Zinc finger": null,
"NR C4-type Zinc finger": null,
"SP-RING-type Zinc finger": null,
"RING-type Zinc finger": null,
"UBZ4-type Zinc finger": null,
"Ig-like C1-type Immunoglobulin domain": null,
"C2HC MYST-type Zinc finger": null,
"RanBP2-type Zinc finger": null,
"Ig-like Immunoglobulin domain": null,
"C3H1-type Zinc finger": null,
"C4-type Zinc finger": null,
"CCHC-type Zinc finger": null,
"RING-type; atypical Zinc finger": null,
"TFIIS-type Zinc finger": null,
"C2H2-type 2; atypical Zinc finger": null,
"RRN7-type Zinc finger": null,
"C2H2-type 1; degenerate Zinc finger": null,
"GATA-type Zinc finger": null,
" Zinc finger": null,
"Phorbol-ester/DAG-type Zinc finger": null,
"CR-type Zinc finger": null,
"GATA-type; atypical Zinc finger": null,
"PHD-type; atypical Zinc finger": null,
"C2H2-type 4; atypical Zinc finger": null,
"B box-type; degenerate Zinc finger": null,
"CCHHC-type Zinc finger": null,
"C2H2-type; atypical Zinc finger": null,
"PHD-type Zinc finger": null,
"SGF11-type Zinc finger": null,
"HIT-type Zinc finger": null,
"C2H2-type 4; degenerate Zinc finger": null,
"FYVE-type; atypical Zinc finger": null,
"FCS-type Zinc finger": null,
"RING-Gid-type Zinc finger": null,
"B box-type 1; atypical Zinc finger": null,
"B box-type Zinc finger": null,
"DNL-type Zinc finger": null,
"CCHH-type Zinc finger": null,
"ZZ-type; degenerate Zinc finger": null,
"C2H2-type 11; degenerate Zinc finger": null,
"UBZ3-type Zinc finger": null,
"PHD-type 2; atypical Zinc finger": null,
"Matrin-type Zinc finger": null,
"MYND-type Zinc finger": null,
"B box-type 2; atypical Zinc finger": null,
"C2H2-type 1; atypical Zinc finger": null,
"TAZ-type Zinc finger": null,
"CHHC U11-48K-type Zinc finger": null,
"UBZ2-type Zinc finger": null,
"C2HC pre-PHD-type Zinc finger": null,
"PHD-type; degenerate Zinc finger": null,
"C2H2-type 3; atypical Zinc finger": null,
"FYVE-type 1; atypical Zinc finger": null,
"FYVE-type Zinc finger": null,
"PARP-type Zinc finger": null,
"Btk-type Zinc finger": null,
"CCHC-type 2; atypical Zinc finger": null,
"ZZ-type Zinc finger": null,
"PHD-type 2; degenerate Zinc finger": null,
"UBP-type; degenerate Zinc finger": null,
"THAP-type Zinc finger": null,
"3CxxC-type Zinc finger": null,
"C2H2-type 6; degenerate Zinc finger": null,
"C2H2-type 7; degenerate Zinc finger": null,
"C2H2-type 9; degenerate Zinc finger": null,
"C2H2-type 6; atypical Zinc finger": null,
"RTR1-type Zinc finger": null,
"CW-type Zinc finger": null,
"FLYWCH-type Zinc finger": null,
"C2H2-type 3; degenerate Zinc finger": null,
"C3HC-type Zinc finger": null,
"CCHHC-type; degenerate Zinc finger": null,
"UBP-type Zinc finger": null,
"UBZ1-type Zinc finger": null,
"B box-type; atypical Zinc finger": null,
"FPG-type Zinc finger": null,
"Dof-type Zinc finger": null,
"ZF-HD dimerization-type; degenerate Zinc finger": null,
"NF-X1-type Zinc finger": null,
"SWIM-type Zinc finger": null,
"C2H2-type 10; degenerate Zinc finger": null,
"C2H2-type 14; degenerate Zinc finger": null,
"CXXC-type Zinc finger": null,
"TFIIB-type Zinc finger": null,
"NOB1 Zinc finger": null,
"C2H2 AKAP95-type Zinc finger": null,
"A20-type Zinc finger": null,
"AN1-type Zinc finger": null,
"MYND-type; atypical Zinc finger": null,
"RING-type 1; atypical Zinc finger": null,
"RING-type 2; atypical Zinc finger": null,
"SIAH-type Zinc finger": null,
"MYND-type; degenerate Zinc finger": null,
"C2H2-type 11; atypical Zinc finger": null
},
"bin_loc": "M",
"split": "train"
} | {
"value": "MALEGLRAKKRLLWRLFLSAFGLLGLYHYWFKIFRLFEVFIPMGICPMAIMPLLKDNFTGVLRHWARPEVLTCTSWGAPIIWDETFDPHVAEREARRQNLTIGLTVFAVGRYLEKYLEHFLVSAEQYFMVGQNVVYYVFTDRPEAVPHVALGQGRLLRVKPVRREKRWQDVSMARMLTLHEALGGQLGREADYVFCLDVDQYFSGNFGPEVLADLVAQLHAWHFRWPRWMLPYERDKRSAAALSLSEGDFYYHAAVFGGSVAALLKLTAHCATGQQLDREHGIEARWHDESHLNKFFWLSKPTKLLSPEFCWAEEIGWRPEIHHPRLIWAPKEYALVRT",
"length": 339,
"molWeight": 39548,
"crc64": "171A191001F0C6CF",
"md5": "3DDF099081363FF1D81EA7108F57BD83"
} |
A0A8M2 | This is Protein LSM14 homolog A-A protein, from African clawed frog, contains 471 amino acids, is soluble, locates in Cytoplasm. | [] | {
"primaryAccession": "A0A8M2",
"organism_name": "African clawed frog",
"protein_name": "Protein LSM14 homolog A-A",
"length": 471,
"firstPublicDate": "2010-02-09T00:00:00",
"FUNCTION": "RNA-binding component of messenger ribonucleoprotein complexes (mRNPs), storage particles that mask maternal mRNAs from the translational apparatus during oocyte maturation (PubMed:17074753), Acts as a repressor of mRNA translation (PubMed:17074753), Probably involved in the storage of translationally inactive mRNAs in the cytoplasm in order to prevent their degradation (PubMed:17074753)",
"SUBCELLULAR LOCATION": "Cytoplasm",
"SIMILARITY": "Belongs to the LSM14 family",
"domain_description": {
"C2H2-type Zinc finger": null,
"C2H2-type; degenerate Zinc finger": null,
"Ig-like V-type Immunoglobulin domain": null,
"RING-type; degenerate Zinc finger": null,
"BED-type Zinc finger": null,
"Ig-like C2-type Immunoglobulin domain": null,
"C5HC2 Zinc finger": null,
"C2H2-type 2; degenerate Zinc finger": null,
"C2H2-type 5; degenerate Zinc finger": null,
"DBF4-type Zinc finger": null,
"RING-CH-type Zinc finger": null,
"NR C4-type Zinc finger": null,
"SP-RING-type Zinc finger": null,
"RING-type Zinc finger": null,
"UBZ4-type Zinc finger": null,
"Ig-like C1-type Immunoglobulin domain": null,
"C2HC MYST-type Zinc finger": null,
"RanBP2-type Zinc finger": null,
"Ig-like Immunoglobulin domain": null,
"C3H1-type Zinc finger": null,
"C4-type Zinc finger": null,
"CCHC-type Zinc finger": null,
"RING-type; atypical Zinc finger": null,
"TFIIS-type Zinc finger": null,
"C2H2-type 2; atypical Zinc finger": null,
"RRN7-type Zinc finger": null,
"C2H2-type 1; degenerate Zinc finger": null,
"GATA-type Zinc finger": null,
" Zinc finger": null,
"Phorbol-ester/DAG-type Zinc finger": null,
"CR-type Zinc finger": null,
"GATA-type; atypical Zinc finger": null,
"PHD-type; atypical Zinc finger": null,
"C2H2-type 4; atypical Zinc finger": null,
"B box-type; degenerate Zinc finger": null,
"CCHHC-type Zinc finger": null,
"C2H2-type; atypical Zinc finger": null,
"PHD-type Zinc finger": null,
"SGF11-type Zinc finger": null,
"HIT-type Zinc finger": null,
"C2H2-type 4; degenerate Zinc finger": null,
"FYVE-type; atypical Zinc finger": null,
"FCS-type Zinc finger": null,
"RING-Gid-type Zinc finger": null,
"B box-type 1; atypical Zinc finger": null,
"B box-type Zinc finger": null,
"DNL-type Zinc finger": null,
"CCHH-type Zinc finger": null,
"ZZ-type; degenerate Zinc finger": null,
"C2H2-type 11; degenerate Zinc finger": null,
"UBZ3-type Zinc finger": null,
"PHD-type 2; atypical Zinc finger": null,
"Matrin-type Zinc finger": null,
"MYND-type Zinc finger": null,
"B box-type 2; atypical Zinc finger": null,
"C2H2-type 1; atypical Zinc finger": null,
"TAZ-type Zinc finger": null,
"CHHC U11-48K-type Zinc finger": null,
"UBZ2-type Zinc finger": null,
"C2HC pre-PHD-type Zinc finger": null,
"PHD-type; degenerate Zinc finger": null,
"C2H2-type 3; atypical Zinc finger": null,
"FYVE-type 1; atypical Zinc finger": null,
"FYVE-type Zinc finger": null,
"PARP-type Zinc finger": null,
"Btk-type Zinc finger": null,
"CCHC-type 2; atypical Zinc finger": null,
"ZZ-type Zinc finger": null,
"PHD-type 2; degenerate Zinc finger": null,
"UBP-type; degenerate Zinc finger": null,
"THAP-type Zinc finger": null,
"3CxxC-type Zinc finger": null,
"C2H2-type 6; degenerate Zinc finger": null,
"C2H2-type 7; degenerate Zinc finger": null,
"C2H2-type 9; degenerate Zinc finger": null,
"C2H2-type 6; atypical Zinc finger": null,
"RTR1-type Zinc finger": null,
"CW-type Zinc finger": null,
"FLYWCH-type Zinc finger": null,
"C2H2-type 3; degenerate Zinc finger": null,
"C3HC-type Zinc finger": null,
"CCHHC-type; degenerate Zinc finger": null,
"UBP-type Zinc finger": null,
"UBZ1-type Zinc finger": null,
"B box-type; atypical Zinc finger": null,
"FPG-type Zinc finger": null,
"Dof-type Zinc finger": null,
"ZF-HD dimerization-type; degenerate Zinc finger": null,
"NF-X1-type Zinc finger": null,
"SWIM-type Zinc finger": null,
"C2H2-type 10; degenerate Zinc finger": null,
"C2H2-type 14; degenerate Zinc finger": null,
"CXXC-type Zinc finger": null,
"TFIIB-type Zinc finger": null,
"NOB1 Zinc finger": null,
"C2H2 AKAP95-type Zinc finger": null,
"A20-type Zinc finger": null,
"AN1-type Zinc finger": null,
"MYND-type; atypical Zinc finger": null,
"RING-type 1; atypical Zinc finger": null,
"RING-type 2; atypical Zinc finger": null,
"SIAH-type Zinc finger": null,
"MYND-type; degenerate Zinc finger": null,
"C2H2-type 11; atypical Zinc finger": null
},
"bin_loc": "S",
"split": "train"
} | {
"value": "MSGGTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEIFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAIVQSSLGSSSASSFQSVSSYGPFGRMPAYSQFNTGPLVGPQFGAVGVGSSLTSFGAETTSSTSLPPSSAVGTSFTQEARTLKTQSSQGQSSSPLDSLRKSPNIEQAVQTAAAPHAPSTATVGRRSPVLSRPVPSSIQKTAESPEQRKGELHKMQRPDIDQLKNDKNDPSKRQPVLSALQPRRGRGGNRGGRGRFGVRRDGPMKFEKDFDFESANAQFNKEEIDREFHNKLKIKDDKPEKPVNGEDKTDSVVDTQNSEGNAEEEEVLAGGVCYYDKTKSFFDNISCDDNRDRRQTWAEERRINVETFGLPLRSNRGRGGFRGRGGGMGFRGGRGRGGERRGAPGGGGFGPARGFRGGFRGGRGGREFADYEYRKDNKVAA",
"length": 471,
"molWeight": 51168,
"crc64": "67A85C7E2FE93398",
"md5": "62E996C53C1B1B9C998DF8A0FC1ABF3D"
} |
A0JNT9 | This is BICD family-like cargo adapter 1 protein, from Mouse, contains 577 amino acids, is soluble, locates in Cytoplasm. | [] | {
"primaryAccession": "A0JNT9",
"organism_name": "Mouse",
"protein_name": "BICD family-like cargo adapter 1",
"length": 577,
"firstPublicDate": "2007-09-11T00:00:00",
"FUNCTION": "Acts as an adapter protein linking the dynein motor complex to various cargos and converts dynein from a non-processive to a highly processive motor in the presence of dynactin, Facilitates the interaction between dynein and dynactin and activates dynein processivity (the ability to move along a microtubule for a long distance without falling off the track), Predominantly recruits 2 dyneins, which increases both the force and speed of the microtubule motor (PubMed:29420470, PubMed:33734450, PubMed:36071160), Component of secretory vesicle machinery in developing neurons that acts as a regulator of neurite outgrowth, Regulates the secretory vesicle transport by controlling the accumulation of Rab6-containing secretory vesicles in the pericentrosomal region restricting anterograde secretory transport during the early phase of neuronal differentiation, thereby inhibiting neuritogenesis",
"SUBCELLULAR LOCATION": "Cytoplasm",
"SIMILARITY": "Belongs to the BICDR family",
"domain_description": {
"C2H2-type Zinc finger": null,
"C2H2-type; degenerate Zinc finger": null,
"Ig-like V-type Immunoglobulin domain": null,
"RING-type; degenerate Zinc finger": null,
"BED-type Zinc finger": null,
"Ig-like C2-type Immunoglobulin domain": null,
"C5HC2 Zinc finger": null,
"C2H2-type 2; degenerate Zinc finger": null,
"C2H2-type 5; degenerate Zinc finger": null,
"DBF4-type Zinc finger": null,
"RING-CH-type Zinc finger": null,
"NR C4-type Zinc finger": null,
"SP-RING-type Zinc finger": null,
"RING-type Zinc finger": null,
"UBZ4-type Zinc finger": null,
"Ig-like C1-type Immunoglobulin domain": null,
"C2HC MYST-type Zinc finger": null,
"RanBP2-type Zinc finger": null,
"Ig-like Immunoglobulin domain": null,
"C3H1-type Zinc finger": null,
"C4-type Zinc finger": null,
"CCHC-type Zinc finger": null,
"RING-type; atypical Zinc finger": null,
"TFIIS-type Zinc finger": null,
"C2H2-type 2; atypical Zinc finger": null,
"RRN7-type Zinc finger": null,
"C2H2-type 1; degenerate Zinc finger": null,
"GATA-type Zinc finger": null,
" Zinc finger": null,
"Phorbol-ester/DAG-type Zinc finger": null,
"CR-type Zinc finger": null,
"GATA-type; atypical Zinc finger": null,
"PHD-type; atypical Zinc finger": null,
"C2H2-type 4; atypical Zinc finger": null,
"B box-type; degenerate Zinc finger": null,
"CCHHC-type Zinc finger": null,
"C2H2-type; atypical Zinc finger": null,
"PHD-type Zinc finger": null,
"SGF11-type Zinc finger": null,
"HIT-type Zinc finger": null,
"C2H2-type 4; degenerate Zinc finger": null,
"FYVE-type; atypical Zinc finger": null,
"FCS-type Zinc finger": null,
"RING-Gid-type Zinc finger": null,
"B box-type 1; atypical Zinc finger": null,
"B box-type Zinc finger": null,
"DNL-type Zinc finger": null,
"CCHH-type Zinc finger": null,
"ZZ-type; degenerate Zinc finger": null,
"C2H2-type 11; degenerate Zinc finger": null,
"UBZ3-type Zinc finger": null,
"PHD-type 2; atypical Zinc finger": null,
"Matrin-type Zinc finger": null,
"MYND-type Zinc finger": null,
"B box-type 2; atypical Zinc finger": null,
"C2H2-type 1; atypical Zinc finger": null,
"TAZ-type Zinc finger": null,
"CHHC U11-48K-type Zinc finger": null,
"UBZ2-type Zinc finger": null,
"C2HC pre-PHD-type Zinc finger": null,
"PHD-type; degenerate Zinc finger": null,
"C2H2-type 3; atypical Zinc finger": null,
"FYVE-type 1; atypical Zinc finger": null,
"FYVE-type Zinc finger": null,
"PARP-type Zinc finger": null,
"Btk-type Zinc finger": null,
"CCHC-type 2; atypical Zinc finger": null,
"ZZ-type Zinc finger": null,
"PHD-type 2; degenerate Zinc finger": null,
"UBP-type; degenerate Zinc finger": null,
"THAP-type Zinc finger": null,
"3CxxC-type Zinc finger": null,
"C2H2-type 6; degenerate Zinc finger": null,
"C2H2-type 7; degenerate Zinc finger": null,
"C2H2-type 9; degenerate Zinc finger": null,
"C2H2-type 6; atypical Zinc finger": null,
"RTR1-type Zinc finger": null,
"CW-type Zinc finger": null,
"FLYWCH-type Zinc finger": null,
"C2H2-type 3; degenerate Zinc finger": null,
"C3HC-type Zinc finger": null,
"CCHHC-type; degenerate Zinc finger": null,
"UBP-type Zinc finger": null,
"UBZ1-type Zinc finger": null,
"B box-type; atypical Zinc finger": null,
"FPG-type Zinc finger": null,
"Dof-type Zinc finger": null,
"ZF-HD dimerization-type; degenerate Zinc finger": null,
"NF-X1-type Zinc finger": null,
"SWIM-type Zinc finger": null,
"C2H2-type 10; degenerate Zinc finger": null,
"C2H2-type 14; degenerate Zinc finger": null,
"CXXC-type Zinc finger": null,
"TFIIB-type Zinc finger": null,
"NOB1 Zinc finger": null,
"C2H2 AKAP95-type Zinc finger": null,
"A20-type Zinc finger": null,
"AN1-type Zinc finger": null,
"MYND-type; atypical Zinc finger": null,
"RING-type 1; atypical Zinc finger": null,
"RING-type 2; atypical Zinc finger": null,
"SIAH-type Zinc finger": null,
"MYND-type; degenerate Zinc finger": null,
"C2H2-type 11; atypical Zinc finger": null
},
"bin_loc": "S",
"split": "train"
} | {
"value": "MSAFCLGLAGRASAPAEPDSACCMELPAGAGDAVRSPATAAALVSFPGGPGELELALEEELALLAAGERSSEPGEHPQAEPESPVEGHGPPLPPPPTQDPELLSVIRQKEKDLVLAARLGKALLERNQDMSRQYEQMHKELTDKLEHLEQEKHELRRRFENREGEWEGRVSELETDVKQLQDELERQQLHLREADREKTRAVQELSEQNQRLLDQLSRASEVERQLSMQVHALKEDFREKNSSTNQHIIRLESLQAEIKMLSDRKRELEHRLSATLEENDLLQGTVEELQDRVLILERQGHDKDLQLHQSQLELQEVRLSYRQLQGKVEELTEERSLQSSAATSTSLLSEIEQSMEAEELEQEREQLRLQLWEAYCQVRYLCSHLRGNDSADSAVSTDSSMDESSETSSAKDVPAGSLRTALNDLKRLIQSIVDGVEPTVTLLSVEMTALKEERDRLRVTSEDKEPKEQLQKAIRDRDEAIAKKNAVELELAKCKMDMMSLNSQLLDAIQQKLNLSQQLEAWQDDMHRVIDRQLMDTHLKEQSRPAAAAFPRGHGVGRGQEPSTADGKRLFSFFRKI",
"length": 577,
"molWeight": 65287,
"crc64": "DD6326D93D663D07",
"md5": "59F4D0E5665BA428B15F146250F5A7F9"
} |
A0JPL0 | This is Zinc finger protein 382 protein, from Rat, contains 549 amino acids, has 10 C2H2-type Zinc finger, locates in Nucleus. | [
{
"location": [
211,
233
],
"description": "C2H2-type",
"keyword_description": "Zinc finger",
"textural_description": "C2H2-type Zinc finger"
},
{
"location": [
295,
317
],
"description": "C2H2-type",
"keyword_description": "Zinc finger",
"textural... | {
"primaryAccession": "A0JPL0",
"organism_name": "Rat",
"protein_name": "Zinc finger protein 382",
"length": 549,
"firstPublicDate": "2009-01-20T00:00:00",
"FUNCTION": "Functions as a sequence-specific transcriptional repressor",
"SUBCELLULAR LOCATION": "Nucleus",
"SIMILARITY": "Belongs to the krueppel C2H2-type zinc-finger protein family",
"domain_description": {
"C2H2-type Zinc finger": 10,
"C2H2-type; degenerate Zinc finger": null,
"Ig-like V-type Immunoglobulin domain": null,
"RING-type; degenerate Zinc finger": null,
"BED-type Zinc finger": null,
"Ig-like C2-type Immunoglobulin domain": null,
"C5HC2 Zinc finger": null,
"C2H2-type 2; degenerate Zinc finger": null,
"C2H2-type 5; degenerate Zinc finger": null,
"DBF4-type Zinc finger": null,
"RING-CH-type Zinc finger": null,
"NR C4-type Zinc finger": null,
"SP-RING-type Zinc finger": null,
"RING-type Zinc finger": null,
"UBZ4-type Zinc finger": null,
"Ig-like C1-type Immunoglobulin domain": null,
"C2HC MYST-type Zinc finger": null,
"RanBP2-type Zinc finger": null,
"Ig-like Immunoglobulin domain": null,
"C3H1-type Zinc finger": null,
"C4-type Zinc finger": null,
"CCHC-type Zinc finger": null,
"RING-type; atypical Zinc finger": null,
"TFIIS-type Zinc finger": null,
"C2H2-type 2; atypical Zinc finger": null,
"RRN7-type Zinc finger": null,
"C2H2-type 1; degenerate Zinc finger": null,
"GATA-type Zinc finger": null,
" Zinc finger": null,
"Phorbol-ester/DAG-type Zinc finger": null,
"CR-type Zinc finger": null,
"GATA-type; atypical Zinc finger": null,
"PHD-type; atypical Zinc finger": null,
"C2H2-type 4; atypical Zinc finger": null,
"B box-type; degenerate Zinc finger": null,
"CCHHC-type Zinc finger": null,
"C2H2-type; atypical Zinc finger": null,
"PHD-type Zinc finger": null,
"SGF11-type Zinc finger": null,
"HIT-type Zinc finger": null,
"C2H2-type 4; degenerate Zinc finger": null,
"FYVE-type; atypical Zinc finger": null,
"FCS-type Zinc finger": null,
"RING-Gid-type Zinc finger": null,
"B box-type 1; atypical Zinc finger": null,
"B box-type Zinc finger": null,
"DNL-type Zinc finger": null,
"CCHH-type Zinc finger": null,
"ZZ-type; degenerate Zinc finger": null,
"C2H2-type 11; degenerate Zinc finger": null,
"UBZ3-type Zinc finger": null,
"PHD-type 2; atypical Zinc finger": null,
"Matrin-type Zinc finger": null,
"MYND-type Zinc finger": null,
"B box-type 2; atypical Zinc finger": null,
"C2H2-type 1; atypical Zinc finger": null,
"TAZ-type Zinc finger": null,
"CHHC U11-48K-type Zinc finger": null,
"UBZ2-type Zinc finger": null,
"C2HC pre-PHD-type Zinc finger": null,
"PHD-type; degenerate Zinc finger": null,
"C2H2-type 3; atypical Zinc finger": null,
"FYVE-type 1; atypical Zinc finger": null,
"FYVE-type Zinc finger": null,
"PARP-type Zinc finger": null,
"Btk-type Zinc finger": null,
"CCHC-type 2; atypical Zinc finger": null,
"ZZ-type Zinc finger": null,
"PHD-type 2; degenerate Zinc finger": null,
"UBP-type; degenerate Zinc finger": null,
"THAP-type Zinc finger": null,
"3CxxC-type Zinc finger": null,
"C2H2-type 6; degenerate Zinc finger": null,
"C2H2-type 7; degenerate Zinc finger": null,
"C2H2-type 9; degenerate Zinc finger": null,
"C2H2-type 6; atypical Zinc finger": null,
"RTR1-type Zinc finger": null,
"CW-type Zinc finger": null,
"FLYWCH-type Zinc finger": null,
"C2H2-type 3; degenerate Zinc finger": null,
"C3HC-type Zinc finger": null,
"CCHHC-type; degenerate Zinc finger": null,
"UBP-type Zinc finger": null,
"UBZ1-type Zinc finger": null,
"B box-type; atypical Zinc finger": null,
"FPG-type Zinc finger": null,
"Dof-type Zinc finger": null,
"ZF-HD dimerization-type; degenerate Zinc finger": null,
"NF-X1-type Zinc finger": null,
"SWIM-type Zinc finger": null,
"C2H2-type 10; degenerate Zinc finger": null,
"C2H2-type 14; degenerate Zinc finger": null,
"CXXC-type Zinc finger": null,
"TFIIB-type Zinc finger": null,
"NOB1 Zinc finger": null,
"C2H2 AKAP95-type Zinc finger": null,
"A20-type Zinc finger": null,
"AN1-type Zinc finger": null,
"MYND-type; atypical Zinc finger": null,
"RING-type 1; atypical Zinc finger": null,
"RING-type 2; atypical Zinc finger": null,
"SIAH-type Zinc finger": null,
"MYND-type; degenerate Zinc finger": null,
"C2H2-type 11; atypical Zinc finger": null
},
"bin_loc": "U",
"split": "train"
} | {
"value": "MNCHSVPLQGPVSFKDVTVDFTQEEWQRLDPAQKALYRDVMLENYCHFISVGFHITKPDMIRKLEQGEELWTERMFPSQSYLEDEEVLVKFRDYQDKPPTSIVIINHKKLIKERNNVYEKTLGNNHIISKTLFEYKSDGKVLKNISDFISRDINPVMGTLGDSSEWEESVLTSEQEKTHPVPTLYKQIGRNLSSSLELAQHQKTQIPEQRFECDECDSSFLMTEVAFPHDRAHRGVRDFNCSKDEIAFFEKSDLGIHPHNLMEKKCSTYNKYGKLLCRKSVFVMHPRSQVDERPFQCPYCGNSFRRKSYLIEHQRIHTGEKPYICSQCGKAFRQKTALTLHEKTHTDGKPYLCVDCGKSFRQKATLTRHHKTHTGEKAYECTQCGSAFGKKSYLIDHQRTHTGEKPYQCAECGKAFIQKTTLTVHQRTHTGEKPYMCSECGKSFCQKTTLTLHQRIHTGEKPYVCSDCGKSFRQKAILTVHYRIHTGEKSNGCPQCGKAFSRKSNLIRHQKTHTGEKPYECHECGKFFSCKSNLVAHQKTHKAETVRFQ",
"length": 549,
"molWeight": 63563,
"crc64": "72B9DA5087E9C177",
"md5": "A51D5EC0379902D2864DF1CA74FAE5B0"
} |
A0PJK1 | This is Sodium/mannose cotransporter SLC5A10 protein, from Human, contains 596 amino acids, is membrane-bound, locates in Cell membrane. | [] | {
"primaryAccession": "A0PJK1",
"organism_name": "Human",
"protein_name": "Sodium/mannose cotransporter SLC5A10",
"length": 596,
"firstPublicDate": "2007-11-13T00:00:00",
"FUNCTION": "Appears to have no transporter activity",
"SUBCELLULAR LOCATION": "Cell membrane",
"SIMILARITY": "Belongs to the sodium:solute symporter (SSF) (TC 2,A,21) family",
"domain_description": {
"C2H2-type Zinc finger": null,
"C2H2-type; degenerate Zinc finger": null,
"Ig-like V-type Immunoglobulin domain": null,
"RING-type; degenerate Zinc finger": null,
"BED-type Zinc finger": null,
"Ig-like C2-type Immunoglobulin domain": null,
"C5HC2 Zinc finger": null,
"C2H2-type 2; degenerate Zinc finger": null,
"C2H2-type 5; degenerate Zinc finger": null,
"DBF4-type Zinc finger": null,
"RING-CH-type Zinc finger": null,
"NR C4-type Zinc finger": null,
"SP-RING-type Zinc finger": null,
"RING-type Zinc finger": null,
"UBZ4-type Zinc finger": null,
"Ig-like C1-type Immunoglobulin domain": null,
"C2HC MYST-type Zinc finger": null,
"RanBP2-type Zinc finger": null,
"Ig-like Immunoglobulin domain": null,
"C3H1-type Zinc finger": null,
"C4-type Zinc finger": null,
"CCHC-type Zinc finger": null,
"RING-type; atypical Zinc finger": null,
"TFIIS-type Zinc finger": null,
"C2H2-type 2; atypical Zinc finger": null,
"RRN7-type Zinc finger": null,
"C2H2-type 1; degenerate Zinc finger": null,
"GATA-type Zinc finger": null,
" Zinc finger": null,
"Phorbol-ester/DAG-type Zinc finger": null,
"CR-type Zinc finger": null,
"GATA-type; atypical Zinc finger": null,
"PHD-type; atypical Zinc finger": null,
"C2H2-type 4; atypical Zinc finger": null,
"B box-type; degenerate Zinc finger": null,
"CCHHC-type Zinc finger": null,
"C2H2-type; atypical Zinc finger": null,
"PHD-type Zinc finger": null,
"SGF11-type Zinc finger": null,
"HIT-type Zinc finger": null,
"C2H2-type 4; degenerate Zinc finger": null,
"FYVE-type; atypical Zinc finger": null,
"FCS-type Zinc finger": null,
"RING-Gid-type Zinc finger": null,
"B box-type 1; atypical Zinc finger": null,
"B box-type Zinc finger": null,
"DNL-type Zinc finger": null,
"CCHH-type Zinc finger": null,
"ZZ-type; degenerate Zinc finger": null,
"C2H2-type 11; degenerate Zinc finger": null,
"UBZ3-type Zinc finger": null,
"PHD-type 2; atypical Zinc finger": null,
"Matrin-type Zinc finger": null,
"MYND-type Zinc finger": null,
"B box-type 2; atypical Zinc finger": null,
"C2H2-type 1; atypical Zinc finger": null,
"TAZ-type Zinc finger": null,
"CHHC U11-48K-type Zinc finger": null,
"UBZ2-type Zinc finger": null,
"C2HC pre-PHD-type Zinc finger": null,
"PHD-type; degenerate Zinc finger": null,
"C2H2-type 3; atypical Zinc finger": null,
"FYVE-type 1; atypical Zinc finger": null,
"FYVE-type Zinc finger": null,
"PARP-type Zinc finger": null,
"Btk-type Zinc finger": null,
"CCHC-type 2; atypical Zinc finger": null,
"ZZ-type Zinc finger": null,
"PHD-type 2; degenerate Zinc finger": null,
"UBP-type; degenerate Zinc finger": null,
"THAP-type Zinc finger": null,
"3CxxC-type Zinc finger": null,
"C2H2-type 6; degenerate Zinc finger": null,
"C2H2-type 7; degenerate Zinc finger": null,
"C2H2-type 9; degenerate Zinc finger": null,
"C2H2-type 6; atypical Zinc finger": null,
"RTR1-type Zinc finger": null,
"CW-type Zinc finger": null,
"FLYWCH-type Zinc finger": null,
"C2H2-type 3; degenerate Zinc finger": null,
"C3HC-type Zinc finger": null,
"CCHHC-type; degenerate Zinc finger": null,
"UBP-type Zinc finger": null,
"UBZ1-type Zinc finger": null,
"B box-type; atypical Zinc finger": null,
"FPG-type Zinc finger": null,
"Dof-type Zinc finger": null,
"ZF-HD dimerization-type; degenerate Zinc finger": null,
"NF-X1-type Zinc finger": null,
"SWIM-type Zinc finger": null,
"C2H2-type 10; degenerate Zinc finger": null,
"C2H2-type 14; degenerate Zinc finger": null,
"CXXC-type Zinc finger": null,
"TFIIB-type Zinc finger": null,
"NOB1 Zinc finger": null,
"C2H2 AKAP95-type Zinc finger": null,
"A20-type Zinc finger": null,
"AN1-type Zinc finger": null,
"MYND-type; atypical Zinc finger": null,
"RING-type 1; atypical Zinc finger": null,
"RING-type 2; atypical Zinc finger": null,
"SIAH-type Zinc finger": null,
"MYND-type; degenerate Zinc finger": null,
"C2H2-type 11; atypical Zinc finger": null
},
"bin_loc": "M",
"split": "train"
} | {
"value": "MAANSTSDLHTPGTQLSVADIIVITVYFALNVAVGIWSSCRASRNTVNGYFLAGRDMTWWPIGASLFASSEGSGLFIGLAGSGAAGGLAVAGFEWNATYVLLALAWVFVPIYISSEIVTLPEYIQKRYGGQRIRMYLSVLSLLLSVFTKISLDLYAGALFVHICLGWNFYLSTILTLGITALYTIAGGLAAVIYTDALQTLIMVVGAVILTIKAFDQIGGYGQLEAAYAQAIPSRTIANTTCHLPRTDAMHMFRDPHTGDLPWTGMTFGLTIMATWYWCTDQVIVQRSLSARDLNHAKAGSILASYLKMLPMGLIIMPGMISRALFPDDVGCVVPSECLRACGAEVGCSNIAYPKLVMELMPIGLRGLMIAVMLAALMSSLTSIFNSSSTLFTMDIWRRLRPRSGERELLLVGRLVIVALIGVSVAWIPVLQDSNSGQLFIYMQSVTSSLAPPVTAVFVLGVFWRRANEQGAFWGLIAGLVVGATRLVLEFLNPAPPCGEPDTRPAVLGSIHYLHFAVALFALSGAVVVAGSLLTPPPQSVQIENLTWWTLAQDVPLGTKAGDGQTPQKHAFWARVCGFNAILLMCVNIFFYAYFA",
"length": 596,
"molWeight": 64342,
"crc64": "73D104A9F8065926",
"md5": "AD575DE0ABBE40E132F031C7B0303C1C"
} |
A0S864 | This is Irditoxin subunit A protein, from Brown tree snake, contains 109 amino acids, is soluble, locates in Extracellular. | [] | {
"primaryAccession": "A0S864",
"organism_name": "Brown tree snake",
"protein_name": "Irditoxin subunit A",
"length": 109,
"firstPublicDate": "2008-01-15T00:00:00",
"FUNCTION": "This bird and reptile-specific postsynaptic neurotoxin inhibits the chick muscle alpha-1-beta-1-gamma-delta (CHRNA1-CHRNB1-CHRNG-CHNRD) nicotinic acetylcholine receptor (nAChR) 100-fold more compared with the mouse receptor, In vivo, produces rapid flaccid paralysis, dyspnea and increased respiratory rate in geckos, At sublethal doses geckos were immobilized for up to three days and then recovered, Chicks injected with lethal doses showed rapid onset of inactivity, dyspnea and neck droop, and no extended paralysis with survival was seen",
"SUBCELLULAR LOCATION": "Extracellular",
"SIMILARITY": "Belongs to the snake three-finger toxin family, Ancestral subfamily, Boigatoxin sub-subfamily",
"domain_description": {
"C2H2-type Zinc finger": null,
"C2H2-type; degenerate Zinc finger": null,
"Ig-like V-type Immunoglobulin domain": null,
"RING-type; degenerate Zinc finger": null,
"BED-type Zinc finger": null,
"Ig-like C2-type Immunoglobulin domain": null,
"C5HC2 Zinc finger": null,
"C2H2-type 2; degenerate Zinc finger": null,
"C2H2-type 5; degenerate Zinc finger": null,
"DBF4-type Zinc finger": null,
"RING-CH-type Zinc finger": null,
"NR C4-type Zinc finger": null,
"SP-RING-type Zinc finger": null,
"RING-type Zinc finger": null,
"UBZ4-type Zinc finger": null,
"Ig-like C1-type Immunoglobulin domain": null,
"C2HC MYST-type Zinc finger": null,
"RanBP2-type Zinc finger": null,
"Ig-like Immunoglobulin domain": null,
"C3H1-type Zinc finger": null,
"C4-type Zinc finger": null,
"CCHC-type Zinc finger": null,
"RING-type; atypical Zinc finger": null,
"TFIIS-type Zinc finger": null,
"C2H2-type 2; atypical Zinc finger": null,
"RRN7-type Zinc finger": null,
"C2H2-type 1; degenerate Zinc finger": null,
"GATA-type Zinc finger": null,
" Zinc finger": null,
"Phorbol-ester/DAG-type Zinc finger": null,
"CR-type Zinc finger": null,
"GATA-type; atypical Zinc finger": null,
"PHD-type; atypical Zinc finger": null,
"C2H2-type 4; atypical Zinc finger": null,
"B box-type; degenerate Zinc finger": null,
"CCHHC-type Zinc finger": null,
"C2H2-type; atypical Zinc finger": null,
"PHD-type Zinc finger": null,
"SGF11-type Zinc finger": null,
"HIT-type Zinc finger": null,
"C2H2-type 4; degenerate Zinc finger": null,
"FYVE-type; atypical Zinc finger": null,
"FCS-type Zinc finger": null,
"RING-Gid-type Zinc finger": null,
"B box-type 1; atypical Zinc finger": null,
"B box-type Zinc finger": null,
"DNL-type Zinc finger": null,
"CCHH-type Zinc finger": null,
"ZZ-type; degenerate Zinc finger": null,
"C2H2-type 11; degenerate Zinc finger": null,
"UBZ3-type Zinc finger": null,
"PHD-type 2; atypical Zinc finger": null,
"Matrin-type Zinc finger": null,
"MYND-type Zinc finger": null,
"B box-type 2; atypical Zinc finger": null,
"C2H2-type 1; atypical Zinc finger": null,
"TAZ-type Zinc finger": null,
"CHHC U11-48K-type Zinc finger": null,
"UBZ2-type Zinc finger": null,
"C2HC pre-PHD-type Zinc finger": null,
"PHD-type; degenerate Zinc finger": null,
"C2H2-type 3; atypical Zinc finger": null,
"FYVE-type 1; atypical Zinc finger": null,
"FYVE-type Zinc finger": null,
"PARP-type Zinc finger": null,
"Btk-type Zinc finger": null,
"CCHC-type 2; atypical Zinc finger": null,
"ZZ-type Zinc finger": null,
"PHD-type 2; degenerate Zinc finger": null,
"UBP-type; degenerate Zinc finger": null,
"THAP-type Zinc finger": null,
"3CxxC-type Zinc finger": null,
"C2H2-type 6; degenerate Zinc finger": null,
"C2H2-type 7; degenerate Zinc finger": null,
"C2H2-type 9; degenerate Zinc finger": null,
"C2H2-type 6; atypical Zinc finger": null,
"RTR1-type Zinc finger": null,
"CW-type Zinc finger": null,
"FLYWCH-type Zinc finger": null,
"C2H2-type 3; degenerate Zinc finger": null,
"C3HC-type Zinc finger": null,
"CCHHC-type; degenerate Zinc finger": null,
"UBP-type Zinc finger": null,
"UBZ1-type Zinc finger": null,
"B box-type; atypical Zinc finger": null,
"FPG-type Zinc finger": null,
"Dof-type Zinc finger": null,
"ZF-HD dimerization-type; degenerate Zinc finger": null,
"NF-X1-type Zinc finger": null,
"SWIM-type Zinc finger": null,
"C2H2-type 10; degenerate Zinc finger": null,
"C2H2-type 14; degenerate Zinc finger": null,
"CXXC-type Zinc finger": null,
"TFIIB-type Zinc finger": null,
"NOB1 Zinc finger": null,
"C2H2 AKAP95-type Zinc finger": null,
"A20-type Zinc finger": null,
"AN1-type Zinc finger": null,
"MYND-type; atypical Zinc finger": null,
"RING-type 1; atypical Zinc finger": null,
"RING-type 2; atypical Zinc finger": null,
"SIAH-type Zinc finger": null,
"MYND-type; degenerate Zinc finger": null,
"C2H2-type 11; atypical Zinc finger": null
},
"bin_loc": "S",
"split": "train"
} | {
"value": "MKTLLLAVAVVAFVCLGSADQLGLGRQQIDWGQGQAVGPPYTLCFECNRMTSSDCSTALRCYRGSCYTLYRPDENCELKWAVKGCAETCPTAGPNERVKCCRSPRCNDD",
"length": 109,
"molWeight": 11938,
"crc64": "D2E1E5D42E467A12",
"md5": "5541F38B86EE1061705EFFCD6632C698"
} |
A0S865 | This is Irditoxin subunit B protein, from Brown tree snake, contains 111 amino acids, is soluble, locates in Extracellular. | [] | {
"primaryAccession": "A0S865",
"organism_name": "Brown tree snake",
"protein_name": "Irditoxin subunit B",
"length": 111,
"firstPublicDate": "2008-01-15T00:00:00",
"FUNCTION": "This bird and reptile-specific postsynaptic neurotoxin inhibits the chick muscle alpha-1-beta-1-gamma-delta (CHRNA1-CHRNB1-CHRNG-CHRND) nicotinic acetylcholine receptor (nAChR) 100-fold more compared with the mouse receptor, In vivo, produces rapid flaccid paralysis, dyspnea and increased respiratory rate in geckos, At sublethal doses geckos were immobilized for up to three days and then recovered, Chicks injected with lethal doses showed rapid onset of inactivity, dyspnea and neck droop, and no extended paralysis with survival was seen",
"SUBCELLULAR LOCATION": "Extracellular",
"SIMILARITY": "Belongs to the snake three-finger toxin family, Ancestral subfamily, Boigatoxin sub-subfamily",
"domain_description": {
"C2H2-type Zinc finger": null,
"C2H2-type; degenerate Zinc finger": null,
"Ig-like V-type Immunoglobulin domain": null,
"RING-type; degenerate Zinc finger": null,
"BED-type Zinc finger": null,
"Ig-like C2-type Immunoglobulin domain": null,
"C5HC2 Zinc finger": null,
"C2H2-type 2; degenerate Zinc finger": null,
"C2H2-type 5; degenerate Zinc finger": null,
"DBF4-type Zinc finger": null,
"RING-CH-type Zinc finger": null,
"NR C4-type Zinc finger": null,
"SP-RING-type Zinc finger": null,
"RING-type Zinc finger": null,
"UBZ4-type Zinc finger": null,
"Ig-like C1-type Immunoglobulin domain": null,
"C2HC MYST-type Zinc finger": null,
"RanBP2-type Zinc finger": null,
"Ig-like Immunoglobulin domain": null,
"C3H1-type Zinc finger": null,
"C4-type Zinc finger": null,
"CCHC-type Zinc finger": null,
"RING-type; atypical Zinc finger": null,
"TFIIS-type Zinc finger": null,
"C2H2-type 2; atypical Zinc finger": null,
"RRN7-type Zinc finger": null,
"C2H2-type 1; degenerate Zinc finger": null,
"GATA-type Zinc finger": null,
" Zinc finger": null,
"Phorbol-ester/DAG-type Zinc finger": null,
"CR-type Zinc finger": null,
"GATA-type; atypical Zinc finger": null,
"PHD-type; atypical Zinc finger": null,
"C2H2-type 4; atypical Zinc finger": null,
"B box-type; degenerate Zinc finger": null,
"CCHHC-type Zinc finger": null,
"C2H2-type; atypical Zinc finger": null,
"PHD-type Zinc finger": null,
"SGF11-type Zinc finger": null,
"HIT-type Zinc finger": null,
"C2H2-type 4; degenerate Zinc finger": null,
"FYVE-type; atypical Zinc finger": null,
"FCS-type Zinc finger": null,
"RING-Gid-type Zinc finger": null,
"B box-type 1; atypical Zinc finger": null,
"B box-type Zinc finger": null,
"DNL-type Zinc finger": null,
"CCHH-type Zinc finger": null,
"ZZ-type; degenerate Zinc finger": null,
"C2H2-type 11; degenerate Zinc finger": null,
"UBZ3-type Zinc finger": null,
"PHD-type 2; atypical Zinc finger": null,
"Matrin-type Zinc finger": null,
"MYND-type Zinc finger": null,
"B box-type 2; atypical Zinc finger": null,
"C2H2-type 1; atypical Zinc finger": null,
"TAZ-type Zinc finger": null,
"CHHC U11-48K-type Zinc finger": null,
"UBZ2-type Zinc finger": null,
"C2HC pre-PHD-type Zinc finger": null,
"PHD-type; degenerate Zinc finger": null,
"C2H2-type 3; atypical Zinc finger": null,
"FYVE-type 1; atypical Zinc finger": null,
"FYVE-type Zinc finger": null,
"PARP-type Zinc finger": null,
"Btk-type Zinc finger": null,
"CCHC-type 2; atypical Zinc finger": null,
"ZZ-type Zinc finger": null,
"PHD-type 2; degenerate Zinc finger": null,
"UBP-type; degenerate Zinc finger": null,
"THAP-type Zinc finger": null,
"3CxxC-type Zinc finger": null,
"C2H2-type 6; degenerate Zinc finger": null,
"C2H2-type 7; degenerate Zinc finger": null,
"C2H2-type 9; degenerate Zinc finger": null,
"C2H2-type 6; atypical Zinc finger": null,
"RTR1-type Zinc finger": null,
"CW-type Zinc finger": null,
"FLYWCH-type Zinc finger": null,
"C2H2-type 3; degenerate Zinc finger": null,
"C3HC-type Zinc finger": null,
"CCHHC-type; degenerate Zinc finger": null,
"UBP-type Zinc finger": null,
"UBZ1-type Zinc finger": null,
"B box-type; atypical Zinc finger": null,
"FPG-type Zinc finger": null,
"Dof-type Zinc finger": null,
"ZF-HD dimerization-type; degenerate Zinc finger": null,
"NF-X1-type Zinc finger": null,
"SWIM-type Zinc finger": null,
"C2H2-type 10; degenerate Zinc finger": null,
"C2H2-type 14; degenerate Zinc finger": null,
"CXXC-type Zinc finger": null,
"TFIIB-type Zinc finger": null,
"NOB1 Zinc finger": null,
"C2H2 AKAP95-type Zinc finger": null,
"A20-type Zinc finger": null,
"AN1-type Zinc finger": null,
"MYND-type; atypical Zinc finger": null,
"RING-type 1; atypical Zinc finger": null,
"RING-type 2; atypical Zinc finger": null,
"SIAH-type Zinc finger": null,
"MYND-type; degenerate Zinc finger": null,
"C2H2-type 11; atypical Zinc finger": null
},
"bin_loc": "S",
"split": "train"
} | {
"value": "MKTLLLAVAVVAFVCLGSADQLGLGRQQIDWGKGQAKGPPYTLCFECNRETCSNCFKDNRCPPYHRTCYTLYRPDGNGEMKWAVKGCAKTCPTAQPGESVQCCNTPKCNDY",
"length": 111,
"molWeight": 12236,
"crc64": "448F0CEE68E92E12",
"md5": "C74EFA125A9245AFC5881535EEA49577"
} |
A1A519 | This is Protein FAM170A protein, from Human, contains 330 amino acids, has 1 C2H2-type; degenerate Zinc finger, locates in Nucleus. | [
{
"location": [
228,
252
],
"description": "C2H2-type; degenerate",
"keyword_description": "Zinc finger",
"textural_description": "C2H2-type; degenerate Zinc finger"
}
] | {
"primaryAccession": "A1A519",
"organism_name": "Human",
"protein_name": "Protein FAM170A",
"length": 330,
"firstPublicDate": "2008-03-18T00:00:00",
"FUNCTION": "Acts as a nuclear transcription factor that positively regulates the expression of heat shock genes, Binds to heat shock promoter elements (HSE)",
"SUBCELLULAR LOCATION": "Nucleus",
"SIMILARITY": "Belongs to the FAM170 family",
"domain_description": {
"C2H2-type Zinc finger": null,
"C2H2-type; degenerate Zinc finger": 1,
"Ig-like V-type Immunoglobulin domain": null,
"RING-type; degenerate Zinc finger": null,
"BED-type Zinc finger": null,
"Ig-like C2-type Immunoglobulin domain": null,
"C5HC2 Zinc finger": null,
"C2H2-type 2; degenerate Zinc finger": null,
"C2H2-type 5; degenerate Zinc finger": null,
"DBF4-type Zinc finger": null,
"RING-CH-type Zinc finger": null,
"NR C4-type Zinc finger": null,
"SP-RING-type Zinc finger": null,
"RING-type Zinc finger": null,
"UBZ4-type Zinc finger": null,
"Ig-like C1-type Immunoglobulin domain": null,
"C2HC MYST-type Zinc finger": null,
"RanBP2-type Zinc finger": null,
"Ig-like Immunoglobulin domain": null,
"C3H1-type Zinc finger": null,
"C4-type Zinc finger": null,
"CCHC-type Zinc finger": null,
"RING-type; atypical Zinc finger": null,
"TFIIS-type Zinc finger": null,
"C2H2-type 2; atypical Zinc finger": null,
"RRN7-type Zinc finger": null,
"C2H2-type 1; degenerate Zinc finger": null,
"GATA-type Zinc finger": null,
" Zinc finger": null,
"Phorbol-ester/DAG-type Zinc finger": null,
"CR-type Zinc finger": null,
"GATA-type; atypical Zinc finger": null,
"PHD-type; atypical Zinc finger": null,
"C2H2-type 4; atypical Zinc finger": null,
"B box-type; degenerate Zinc finger": null,
"CCHHC-type Zinc finger": null,
"C2H2-type; atypical Zinc finger": null,
"PHD-type Zinc finger": null,
"SGF11-type Zinc finger": null,
"HIT-type Zinc finger": null,
"C2H2-type 4; degenerate Zinc finger": null,
"FYVE-type; atypical Zinc finger": null,
"FCS-type Zinc finger": null,
"RING-Gid-type Zinc finger": null,
"B box-type 1; atypical Zinc finger": null,
"B box-type Zinc finger": null,
"DNL-type Zinc finger": null,
"CCHH-type Zinc finger": null,
"ZZ-type; degenerate Zinc finger": null,
"C2H2-type 11; degenerate Zinc finger": null,
"UBZ3-type Zinc finger": null,
"PHD-type 2; atypical Zinc finger": null,
"Matrin-type Zinc finger": null,
"MYND-type Zinc finger": null,
"B box-type 2; atypical Zinc finger": null,
"C2H2-type 1; atypical Zinc finger": null,
"TAZ-type Zinc finger": null,
"CHHC U11-48K-type Zinc finger": null,
"UBZ2-type Zinc finger": null,
"C2HC pre-PHD-type Zinc finger": null,
"PHD-type; degenerate Zinc finger": null,
"C2H2-type 3; atypical Zinc finger": null,
"FYVE-type 1; atypical Zinc finger": null,
"FYVE-type Zinc finger": null,
"PARP-type Zinc finger": null,
"Btk-type Zinc finger": null,
"CCHC-type 2; atypical Zinc finger": null,
"ZZ-type Zinc finger": null,
"PHD-type 2; degenerate Zinc finger": null,
"UBP-type; degenerate Zinc finger": null,
"THAP-type Zinc finger": null,
"3CxxC-type Zinc finger": null,
"C2H2-type 6; degenerate Zinc finger": null,
"C2H2-type 7; degenerate Zinc finger": null,
"C2H2-type 9; degenerate Zinc finger": null,
"C2H2-type 6; atypical Zinc finger": null,
"RTR1-type Zinc finger": null,
"CW-type Zinc finger": null,
"FLYWCH-type Zinc finger": null,
"C2H2-type 3; degenerate Zinc finger": null,
"C3HC-type Zinc finger": null,
"CCHHC-type; degenerate Zinc finger": null,
"UBP-type Zinc finger": null,
"UBZ1-type Zinc finger": null,
"B box-type; atypical Zinc finger": null,
"FPG-type Zinc finger": null,
"Dof-type Zinc finger": null,
"ZF-HD dimerization-type; degenerate Zinc finger": null,
"NF-X1-type Zinc finger": null,
"SWIM-type Zinc finger": null,
"C2H2-type 10; degenerate Zinc finger": null,
"C2H2-type 14; degenerate Zinc finger": null,
"CXXC-type Zinc finger": null,
"TFIIB-type Zinc finger": null,
"NOB1 Zinc finger": null,
"C2H2 AKAP95-type Zinc finger": null,
"A20-type Zinc finger": null,
"AN1-type Zinc finger": null,
"MYND-type; atypical Zinc finger": null,
"RING-type 1; atypical Zinc finger": null,
"RING-type 2; atypical Zinc finger": null,
"SIAH-type Zinc finger": null,
"MYND-type; degenerate Zinc finger": null,
"C2H2-type 11; atypical Zinc finger": null
},
"bin_loc": "U",
"split": "train"
} | {
"value": "MKRRQKRKHLENEESQETAEKGGGMSKSQEDALQPGSTRVAKGWSQGVGEVTSTSEYCSCVSSSRKLIHSGIQRIHRDSPQPQSPLAQVQERGETPPRSQHVSLSSYSSYKTCVSSLCVNKEERGMKIYYMQVQMNKGVAVSWETEETLESLEKQPRMEEVTLSEVVRVGTPPSDVSTRNLLSDSEPSGEEKEHEERTESDSLPGSPTVEDTPRAKTPDWLVTMENGFRCMACCRVFTTMEALQEHVQFGIREGFSCHVFHLTMAQLTGNMESESTQDEQEEENGNEKEEEEKPEAKEEEGQPTEEDLGLRRSWSQCPGCVFHSPKDRNS",
"length": 330,
"molWeight": 37158,
"crc64": "DAE7F2D1E96D90AD",
"md5": "AFA8BA0D6E85A3D327FA76A990F03A93"
} |
A1A5B4 | This is Anoctamin-9 protein, from Human, contains 782 amino acids, is membrane-bound, locates in Cell membrane. | [] | {
"primaryAccession": "A1A5B4",
"organism_name": "Human",
"protein_name": "Anoctamin-9",
"length": 782,
"firstPublicDate": "2007-05-29T00:00:00",
"FUNCTION": "Has calcium-dependent phospholipid scramblase activity; scrambles phosphatidylserine, phosphatidylcholine and galactosylceramide (By similarity), Does not exhibit calcium-activated chloride channel (CaCC) activity (PubMed:22178883), Can inhibit the activity of ANO1 (PubMed:20056604, PubMed:22946059)",
"SUBCELLULAR LOCATION": "Cell membrane",
"SIMILARITY": "Belongs to the anoctamin family",
"domain_description": {
"C2H2-type Zinc finger": null,
"C2H2-type; degenerate Zinc finger": null,
"Ig-like V-type Immunoglobulin domain": null,
"RING-type; degenerate Zinc finger": null,
"BED-type Zinc finger": null,
"Ig-like C2-type Immunoglobulin domain": null,
"C5HC2 Zinc finger": null,
"C2H2-type 2; degenerate Zinc finger": null,
"C2H2-type 5; degenerate Zinc finger": null,
"DBF4-type Zinc finger": null,
"RING-CH-type Zinc finger": null,
"NR C4-type Zinc finger": null,
"SP-RING-type Zinc finger": null,
"RING-type Zinc finger": null,
"UBZ4-type Zinc finger": null,
"Ig-like C1-type Immunoglobulin domain": null,
"C2HC MYST-type Zinc finger": null,
"RanBP2-type Zinc finger": null,
"Ig-like Immunoglobulin domain": null,
"C3H1-type Zinc finger": null,
"C4-type Zinc finger": null,
"CCHC-type Zinc finger": null,
"RING-type; atypical Zinc finger": null,
"TFIIS-type Zinc finger": null,
"C2H2-type 2; atypical Zinc finger": null,
"RRN7-type Zinc finger": null,
"C2H2-type 1; degenerate Zinc finger": null,
"GATA-type Zinc finger": null,
" Zinc finger": null,
"Phorbol-ester/DAG-type Zinc finger": null,
"CR-type Zinc finger": null,
"GATA-type; atypical Zinc finger": null,
"PHD-type; atypical Zinc finger": null,
"C2H2-type 4; atypical Zinc finger": null,
"B box-type; degenerate Zinc finger": null,
"CCHHC-type Zinc finger": null,
"C2H2-type; atypical Zinc finger": null,
"PHD-type Zinc finger": null,
"SGF11-type Zinc finger": null,
"HIT-type Zinc finger": null,
"C2H2-type 4; degenerate Zinc finger": null,
"FYVE-type; atypical Zinc finger": null,
"FCS-type Zinc finger": null,
"RING-Gid-type Zinc finger": null,
"B box-type 1; atypical Zinc finger": null,
"B box-type Zinc finger": null,
"DNL-type Zinc finger": null,
"CCHH-type Zinc finger": null,
"ZZ-type; degenerate Zinc finger": null,
"C2H2-type 11; degenerate Zinc finger": null,
"UBZ3-type Zinc finger": null,
"PHD-type 2; atypical Zinc finger": null,
"Matrin-type Zinc finger": null,
"MYND-type Zinc finger": null,
"B box-type 2; atypical Zinc finger": null,
"C2H2-type 1; atypical Zinc finger": null,
"TAZ-type Zinc finger": null,
"CHHC U11-48K-type Zinc finger": null,
"UBZ2-type Zinc finger": null,
"C2HC pre-PHD-type Zinc finger": null,
"PHD-type; degenerate Zinc finger": null,
"C2H2-type 3; atypical Zinc finger": null,
"FYVE-type 1; atypical Zinc finger": null,
"FYVE-type Zinc finger": null,
"PARP-type Zinc finger": null,
"Btk-type Zinc finger": null,
"CCHC-type 2; atypical Zinc finger": null,
"ZZ-type Zinc finger": null,
"PHD-type 2; degenerate Zinc finger": null,
"UBP-type; degenerate Zinc finger": null,
"THAP-type Zinc finger": null,
"3CxxC-type Zinc finger": null,
"C2H2-type 6; degenerate Zinc finger": null,
"C2H2-type 7; degenerate Zinc finger": null,
"C2H2-type 9; degenerate Zinc finger": null,
"C2H2-type 6; atypical Zinc finger": null,
"RTR1-type Zinc finger": null,
"CW-type Zinc finger": null,
"FLYWCH-type Zinc finger": null,
"C2H2-type 3; degenerate Zinc finger": null,
"C3HC-type Zinc finger": null,
"CCHHC-type; degenerate Zinc finger": null,
"UBP-type Zinc finger": null,
"UBZ1-type Zinc finger": null,
"B box-type; atypical Zinc finger": null,
"FPG-type Zinc finger": null,
"Dof-type Zinc finger": null,
"ZF-HD dimerization-type; degenerate Zinc finger": null,
"NF-X1-type Zinc finger": null,
"SWIM-type Zinc finger": null,
"C2H2-type 10; degenerate Zinc finger": null,
"C2H2-type 14; degenerate Zinc finger": null,
"CXXC-type Zinc finger": null,
"TFIIB-type Zinc finger": null,
"NOB1 Zinc finger": null,
"C2H2 AKAP95-type Zinc finger": null,
"A20-type Zinc finger": null,
"AN1-type Zinc finger": null,
"MYND-type; atypical Zinc finger": null,
"RING-type 1; atypical Zinc finger": null,
"RING-type 2; atypical Zinc finger": null,
"SIAH-type Zinc finger": null,
"MYND-type; degenerate Zinc finger": null,
"C2H2-type 11; atypical Zinc finger": null
},
"bin_loc": "M",
"split": "train"
} | {
"value": "MQGEESLRILVEPEGDSFPLMEISTCETEASEQWDYVLVAQRHTQRDPRQARQQQFLEELRRKGFHIKVIRDQKQVFFGIRADNSVFGLYRTLLLEPEGPAPHAELAAPTTIPVTTSLRIRIVNFVVMNNKTSAGETFEDLMKDGVFEARFPLHKGEGRLKKTWARWRHMFREQPVDEIRNYFGEKVALYFVWLGWYTYMLVPAALTGLLVFLSGFSLFEASQISKEICEAHDILMCPLGDHSRRYQRLSETCTFAKLTHLFDNDGTVVFAIFMALWATVFLEIWKRQRARVVLHWDLYVWDEEQEEMALQLINCPDYKLRPYQHSYLRSTVILVLTLLMICLMIGMAHVLVVYRVLASALFSSSAVPFLEEQVTTAVVVTGALVHYVTIIIMTKINRCVALKLCDFEMPRTFSERESRFTIRFFTLQFFTHFSSLIYIAFILGRINGHPGKSTRLAGLWKLEECHASGCMMDLFVQMAIIMGLKQTLSNCVEYLVPWVTHKCRSLRASESGHLPRDPELRDWRRNYLLNPVNTFSLFDEFMEMMIQYGFTTIFVAAFPLAPLLALFSNLVEIRLDAIKMVWLQRRLVPRKAKDIGTWLQVLETIGVLAVIANGMVIAFTSEFIPRVVYKYRYSPCLKEGNSTVDCLKGYVNHSLSVFHTKDFQDPDGIEGSENVTLCRYRDYRNPPDYNFSEQFWFLLAIRLAFVILFEHVALCIKLIAAWFVPDIPQSVKNKVLEVKYQRLREKMWHGRQRLGGVGAGSRPPMPAHPTPASIFSARSTDV",
"length": 782,
"molWeight": 90333,
"crc64": "6A359B63DD92AFF7",
"md5": "319E6FABE64FFD86E869686F0C662EF2"
} |
A1L167 | This is Ubiquitin-conjugating enzyme E2Q-like protein 1 protein, from Human, contains 161 amino acids, locates in Nucleus. | [] | {
"primaryAccession": "A1L167",
"organism_name": "Human",
"protein_name": "Ubiquitin-conjugating enzyme E2Q-like protein 1",
"length": 161,
"firstPublicDate": "2008-05-20T00:00:00",
"FUNCTION": "Probable E2 ubiquitin-protein ligase that catalyzes the covalent attachment of ubiquitin to target proteins, May facilitate the monoubiquitination and degradation of MTOR and CCNE1 through interaction with FBXW7",
"SUBCELLULAR LOCATION": "Nucleus",
"SIMILARITY": "Belongs to the ubiquitin-conjugating enzyme family",
"domain_description": {
"C2H2-type Zinc finger": null,
"C2H2-type; degenerate Zinc finger": null,
"Ig-like V-type Immunoglobulin domain": null,
"RING-type; degenerate Zinc finger": null,
"BED-type Zinc finger": null,
"Ig-like C2-type Immunoglobulin domain": null,
"C5HC2 Zinc finger": null,
"C2H2-type 2; degenerate Zinc finger": null,
"C2H2-type 5; degenerate Zinc finger": null,
"DBF4-type Zinc finger": null,
"RING-CH-type Zinc finger": null,
"NR C4-type Zinc finger": null,
"SP-RING-type Zinc finger": null,
"RING-type Zinc finger": null,
"UBZ4-type Zinc finger": null,
"Ig-like C1-type Immunoglobulin domain": null,
"C2HC MYST-type Zinc finger": null,
"RanBP2-type Zinc finger": null,
"Ig-like Immunoglobulin domain": null,
"C3H1-type Zinc finger": null,
"C4-type Zinc finger": null,
"CCHC-type Zinc finger": null,
"RING-type; atypical Zinc finger": null,
"TFIIS-type Zinc finger": null,
"C2H2-type 2; atypical Zinc finger": null,
"RRN7-type Zinc finger": null,
"C2H2-type 1; degenerate Zinc finger": null,
"GATA-type Zinc finger": null,
" Zinc finger": null,
"Phorbol-ester/DAG-type Zinc finger": null,
"CR-type Zinc finger": null,
"GATA-type; atypical Zinc finger": null,
"PHD-type; atypical Zinc finger": null,
"C2H2-type 4; atypical Zinc finger": null,
"B box-type; degenerate Zinc finger": null,
"CCHHC-type Zinc finger": null,
"C2H2-type; atypical Zinc finger": null,
"PHD-type Zinc finger": null,
"SGF11-type Zinc finger": null,
"HIT-type Zinc finger": null,
"C2H2-type 4; degenerate Zinc finger": null,
"FYVE-type; atypical Zinc finger": null,
"FCS-type Zinc finger": null,
"RING-Gid-type Zinc finger": null,
"B box-type 1; atypical Zinc finger": null,
"B box-type Zinc finger": null,
"DNL-type Zinc finger": null,
"CCHH-type Zinc finger": null,
"ZZ-type; degenerate Zinc finger": null,
"C2H2-type 11; degenerate Zinc finger": null,
"UBZ3-type Zinc finger": null,
"PHD-type 2; atypical Zinc finger": null,
"Matrin-type Zinc finger": null,
"MYND-type Zinc finger": null,
"B box-type 2; atypical Zinc finger": null,
"C2H2-type 1; atypical Zinc finger": null,
"TAZ-type Zinc finger": null,
"CHHC U11-48K-type Zinc finger": null,
"UBZ2-type Zinc finger": null,
"C2HC pre-PHD-type Zinc finger": null,
"PHD-type; degenerate Zinc finger": null,
"C2H2-type 3; atypical Zinc finger": null,
"FYVE-type 1; atypical Zinc finger": null,
"FYVE-type Zinc finger": null,
"PARP-type Zinc finger": null,
"Btk-type Zinc finger": null,
"CCHC-type 2; atypical Zinc finger": null,
"ZZ-type Zinc finger": null,
"PHD-type 2; degenerate Zinc finger": null,
"UBP-type; degenerate Zinc finger": null,
"THAP-type Zinc finger": null,
"3CxxC-type Zinc finger": null,
"C2H2-type 6; degenerate Zinc finger": null,
"C2H2-type 7; degenerate Zinc finger": null,
"C2H2-type 9; degenerate Zinc finger": null,
"C2H2-type 6; atypical Zinc finger": null,
"RTR1-type Zinc finger": null,
"CW-type Zinc finger": null,
"FLYWCH-type Zinc finger": null,
"C2H2-type 3; degenerate Zinc finger": null,
"C3HC-type Zinc finger": null,
"CCHHC-type; degenerate Zinc finger": null,
"UBP-type Zinc finger": null,
"UBZ1-type Zinc finger": null,
"B box-type; atypical Zinc finger": null,
"FPG-type Zinc finger": null,
"Dof-type Zinc finger": null,
"ZF-HD dimerization-type; degenerate Zinc finger": null,
"NF-X1-type Zinc finger": null,
"SWIM-type Zinc finger": null,
"C2H2-type 10; degenerate Zinc finger": null,
"C2H2-type 14; degenerate Zinc finger": null,
"CXXC-type Zinc finger": null,
"TFIIB-type Zinc finger": null,
"NOB1 Zinc finger": null,
"C2H2 AKAP95-type Zinc finger": null,
"A20-type Zinc finger": null,
"AN1-type Zinc finger": null,
"MYND-type; atypical Zinc finger": null,
"RING-type 1; atypical Zinc finger": null,
"RING-type 2; atypical Zinc finger": null,
"SIAH-type Zinc finger": null,
"MYND-type; degenerate Zinc finger": null,
"C2H2-type 11; atypical Zinc finger": null
},
"bin_loc": "U",
"split": "train"
} | {
"value": "MKELQDIARLSDRFISVELVDESLFDWNVKLHQVDKDSVLWQDMKETNTEFILLNLTFPDNFPFSPPFMRVLSPRLENGYVLDGGAICMELLTPRGWSSAYTVEAVMRQFAASLVKGQGRICRKAGKSKKSFSRKEAEATFKSLVKTHEKYGWVTPPVSDG",
"length": 161,
"molWeight": 18338,
"crc64": "B2062702B5EFB2A2",
"md5": "1C92D5FD1F67D62E8F9F1BA47135EE90"
} |
A1L3G9 | This is Nuclear envelope integral membrane protein 1b protein, from African clawed frog, contains 434 amino acids, is membrane-bound, locates in Nucleus. | [] | {
"primaryAccession": "A1L3G9",
"organism_name": "African clawed frog",
"protein_name": "Nuclear envelope integral membrane protein 1b",
"length": 434,
"firstPublicDate": "2008-04-29T00:00:00",
"FUNCTION": "In concert with ran, required for proper eye development (PubMed:25946333), May be involved in the expression of early eye marker genes (PubMed:19167377), Contributes to nuclear envelope stiffness in germ cells (By similarity), Required for fertility (By similarity)",
"SUBCELLULAR LOCATION": "Nucleus",
"SIMILARITY": "Belongs to the NEMP family",
"domain_description": {
"C2H2-type Zinc finger": null,
"C2H2-type; degenerate Zinc finger": null,
"Ig-like V-type Immunoglobulin domain": null,
"RING-type; degenerate Zinc finger": null,
"BED-type Zinc finger": null,
"Ig-like C2-type Immunoglobulin domain": null,
"C5HC2 Zinc finger": null,
"C2H2-type 2; degenerate Zinc finger": null,
"C2H2-type 5; degenerate Zinc finger": null,
"DBF4-type Zinc finger": null,
"RING-CH-type Zinc finger": null,
"NR C4-type Zinc finger": null,
"SP-RING-type Zinc finger": null,
"RING-type Zinc finger": null,
"UBZ4-type Zinc finger": null,
"Ig-like C1-type Immunoglobulin domain": null,
"C2HC MYST-type Zinc finger": null,
"RanBP2-type Zinc finger": null,
"Ig-like Immunoglobulin domain": null,
"C3H1-type Zinc finger": null,
"C4-type Zinc finger": null,
"CCHC-type Zinc finger": null,
"RING-type; atypical Zinc finger": null,
"TFIIS-type Zinc finger": null,
"C2H2-type 2; atypical Zinc finger": null,
"RRN7-type Zinc finger": null,
"C2H2-type 1; degenerate Zinc finger": null,
"GATA-type Zinc finger": null,
" Zinc finger": null,
"Phorbol-ester/DAG-type Zinc finger": null,
"CR-type Zinc finger": null,
"GATA-type; atypical Zinc finger": null,
"PHD-type; atypical Zinc finger": null,
"C2H2-type 4; atypical Zinc finger": null,
"B box-type; degenerate Zinc finger": null,
"CCHHC-type Zinc finger": null,
"C2H2-type; atypical Zinc finger": null,
"PHD-type Zinc finger": null,
"SGF11-type Zinc finger": null,
"HIT-type Zinc finger": null,
"C2H2-type 4; degenerate Zinc finger": null,
"FYVE-type; atypical Zinc finger": null,
"FCS-type Zinc finger": null,
"RING-Gid-type Zinc finger": null,
"B box-type 1; atypical Zinc finger": null,
"B box-type Zinc finger": null,
"DNL-type Zinc finger": null,
"CCHH-type Zinc finger": null,
"ZZ-type; degenerate Zinc finger": null,
"C2H2-type 11; degenerate Zinc finger": null,
"UBZ3-type Zinc finger": null,
"PHD-type 2; atypical Zinc finger": null,
"Matrin-type Zinc finger": null,
"MYND-type Zinc finger": null,
"B box-type 2; atypical Zinc finger": null,
"C2H2-type 1; atypical Zinc finger": null,
"TAZ-type Zinc finger": null,
"CHHC U11-48K-type Zinc finger": null,
"UBZ2-type Zinc finger": null,
"C2HC pre-PHD-type Zinc finger": null,
"PHD-type; degenerate Zinc finger": null,
"C2H2-type 3; atypical Zinc finger": null,
"FYVE-type 1; atypical Zinc finger": null,
"FYVE-type Zinc finger": null,
"PARP-type Zinc finger": null,
"Btk-type Zinc finger": null,
"CCHC-type 2; atypical Zinc finger": null,
"ZZ-type Zinc finger": null,
"PHD-type 2; degenerate Zinc finger": null,
"UBP-type; degenerate Zinc finger": null,
"THAP-type Zinc finger": null,
"3CxxC-type Zinc finger": null,
"C2H2-type 6; degenerate Zinc finger": null,
"C2H2-type 7; degenerate Zinc finger": null,
"C2H2-type 9; degenerate Zinc finger": null,
"C2H2-type 6; atypical Zinc finger": null,
"RTR1-type Zinc finger": null,
"CW-type Zinc finger": null,
"FLYWCH-type Zinc finger": null,
"C2H2-type 3; degenerate Zinc finger": null,
"C3HC-type Zinc finger": null,
"CCHHC-type; degenerate Zinc finger": null,
"UBP-type Zinc finger": null,
"UBZ1-type Zinc finger": null,
"B box-type; atypical Zinc finger": null,
"FPG-type Zinc finger": null,
"Dof-type Zinc finger": null,
"ZF-HD dimerization-type; degenerate Zinc finger": null,
"NF-X1-type Zinc finger": null,
"SWIM-type Zinc finger": null,
"C2H2-type 10; degenerate Zinc finger": null,
"C2H2-type 14; degenerate Zinc finger": null,
"CXXC-type Zinc finger": null,
"TFIIB-type Zinc finger": null,
"NOB1 Zinc finger": null,
"C2H2 AKAP95-type Zinc finger": null,
"A20-type Zinc finger": null,
"AN1-type Zinc finger": null,
"MYND-type; atypical Zinc finger": null,
"RING-type 1; atypical Zinc finger": null,
"RING-type 2; atypical Zinc finger": null,
"SIAH-type Zinc finger": null,
"MYND-type; degenerate Zinc finger": null,
"C2H2-type 11; atypical Zinc finger": null
},
"bin_loc": "M",
"split": "train"
} | {
"value": "MAGEVEGRGCGFSLGVLVTLLVLPLPSLCTLSTEKELHVIKLYEGRMVRYNESRNFCYQRTYEPKWSDVWTKIQIRINSTKMIRVTQVDNEEKLKEMETFNMFDFFSSFLKEKLNDTFIYVNLYSNKTCVKVHLTDTDTYYSVALSRGFDPRLFFVFLCGLLLFFYGDTLSRSQLFFYSTGITVGMLASMLILVFMLSKLMPKKSPFFALLLGGWSVSIYVIQLVFRNLQAICSEYWQYLIVYLGIVGFVSFAFCYIYGPLENERSINILNWTLQLIGLLLMYVSVQIQHIAVTIVVIAFCTKQIEYPVQWIYILYRKIKLKRAKPGPPRLLTEEEYRKQADVETRKALEELRECCSSPDFAAWKTISRIQSPKRFADFVEGSSHLTPNEVSVHEHEYGLGGSFLEDELFGEDSDVEEEMEIEPPLYPIPRSVF",
"length": 434,
"molWeight": 50327,
"crc64": "258089C9B16BA011",
"md5": "1DBF9DF4BDD232188F617EF016B53053"
} |
A1L3X0 | This is Elongation of very long chain fatty acids protein 7 protein, from Human, contains 281 amino acids, is membrane-bound, locates in Endoplasmic reticulum. | [] | {
"primaryAccession": "A1L3X0",
"organism_name": "Human",
"protein_name": "Elongation of very long chain fatty acids protein 7",
"length": 281,
"firstPublicDate": "2007-12-04T00:00:00",
"FUNCTION": "Catalyzes the first and rate-limiting reaction of the four reactions that constitute the long-chain fatty acids elongation cycle, This endoplasmic reticulum-bound enzymatic process allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle, Condensing enzyme with higher activity toward C18 acyl-CoAs, especially C18:3(n-3) acyl-CoAs and C18:3(n-6)-CoAs, Also active toward C20:4-, C18:0-, C18:1-, C18:2- and C16:0-CoAs, and weakly toward C20:0-CoA, Little or no activity toward C22:0-, C24:0-, or C26:0-CoAs, May participate in the production of saturated and polyunsaturated VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators",
"SUBCELLULAR LOCATION": "Endoplasmic reticulum",
"SIMILARITY": "Belongs to the ELO family, ELOVL7 subfamily",
"domain_description": {
"C2H2-type Zinc finger": null,
"C2H2-type; degenerate Zinc finger": null,
"Ig-like V-type Immunoglobulin domain": null,
"RING-type; degenerate Zinc finger": null,
"BED-type Zinc finger": null,
"Ig-like C2-type Immunoglobulin domain": null,
"C5HC2 Zinc finger": null,
"C2H2-type 2; degenerate Zinc finger": null,
"C2H2-type 5; degenerate Zinc finger": null,
"DBF4-type Zinc finger": null,
"RING-CH-type Zinc finger": null,
"NR C4-type Zinc finger": null,
"SP-RING-type Zinc finger": null,
"RING-type Zinc finger": null,
"UBZ4-type Zinc finger": null,
"Ig-like C1-type Immunoglobulin domain": null,
"C2HC MYST-type Zinc finger": null,
"RanBP2-type Zinc finger": null,
"Ig-like Immunoglobulin domain": null,
"C3H1-type Zinc finger": null,
"C4-type Zinc finger": null,
"CCHC-type Zinc finger": null,
"RING-type; atypical Zinc finger": null,
"TFIIS-type Zinc finger": null,
"C2H2-type 2; atypical Zinc finger": null,
"RRN7-type Zinc finger": null,
"C2H2-type 1; degenerate Zinc finger": null,
"GATA-type Zinc finger": null,
" Zinc finger": null,
"Phorbol-ester/DAG-type Zinc finger": null,
"CR-type Zinc finger": null,
"GATA-type; atypical Zinc finger": null,
"PHD-type; atypical Zinc finger": null,
"C2H2-type 4; atypical Zinc finger": null,
"B box-type; degenerate Zinc finger": null,
"CCHHC-type Zinc finger": null,
"C2H2-type; atypical Zinc finger": null,
"PHD-type Zinc finger": null,
"SGF11-type Zinc finger": null,
"HIT-type Zinc finger": null,
"C2H2-type 4; degenerate Zinc finger": null,
"FYVE-type; atypical Zinc finger": null,
"FCS-type Zinc finger": null,
"RING-Gid-type Zinc finger": null,
"B box-type 1; atypical Zinc finger": null,
"B box-type Zinc finger": null,
"DNL-type Zinc finger": null,
"CCHH-type Zinc finger": null,
"ZZ-type; degenerate Zinc finger": null,
"C2H2-type 11; degenerate Zinc finger": null,
"UBZ3-type Zinc finger": null,
"PHD-type 2; atypical Zinc finger": null,
"Matrin-type Zinc finger": null,
"MYND-type Zinc finger": null,
"B box-type 2; atypical Zinc finger": null,
"C2H2-type 1; atypical Zinc finger": null,
"TAZ-type Zinc finger": null,
"CHHC U11-48K-type Zinc finger": null,
"UBZ2-type Zinc finger": null,
"C2HC pre-PHD-type Zinc finger": null,
"PHD-type; degenerate Zinc finger": null,
"C2H2-type 3; atypical Zinc finger": null,
"FYVE-type 1; atypical Zinc finger": null,
"FYVE-type Zinc finger": null,
"PARP-type Zinc finger": null,
"Btk-type Zinc finger": null,
"CCHC-type 2; atypical Zinc finger": null,
"ZZ-type Zinc finger": null,
"PHD-type 2; degenerate Zinc finger": null,
"UBP-type; degenerate Zinc finger": null,
"THAP-type Zinc finger": null,
"3CxxC-type Zinc finger": null,
"C2H2-type 6; degenerate Zinc finger": null,
"C2H2-type 7; degenerate Zinc finger": null,
"C2H2-type 9; degenerate Zinc finger": null,
"C2H2-type 6; atypical Zinc finger": null,
"RTR1-type Zinc finger": null,
"CW-type Zinc finger": null,
"FLYWCH-type Zinc finger": null,
"C2H2-type 3; degenerate Zinc finger": null,
"C3HC-type Zinc finger": null,
"CCHHC-type; degenerate Zinc finger": null,
"UBP-type Zinc finger": null,
"UBZ1-type Zinc finger": null,
"B box-type; atypical Zinc finger": null,
"FPG-type Zinc finger": null,
"Dof-type Zinc finger": null,
"ZF-HD dimerization-type; degenerate Zinc finger": null,
"NF-X1-type Zinc finger": null,
"SWIM-type Zinc finger": null,
"C2H2-type 10; degenerate Zinc finger": null,
"C2H2-type 14; degenerate Zinc finger": null,
"CXXC-type Zinc finger": null,
"TFIIB-type Zinc finger": null,
"NOB1 Zinc finger": null,
"C2H2 AKAP95-type Zinc finger": null,
"A20-type Zinc finger": null,
"AN1-type Zinc finger": null,
"MYND-type; atypical Zinc finger": null,
"RING-type 1; atypical Zinc finger": null,
"RING-type 2; atypical Zinc finger": null,
"SIAH-type Zinc finger": null,
"MYND-type; degenerate Zinc finger": null,
"C2H2-type 11; atypical Zinc finger": null
},
"bin_loc": "M",
"split": "train"
} | {
"value": "MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYEFVMSGWGIGYSFRCDIVDYSRSPTALRMARTCWLYYFSKFIELLDTIFFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHALLNTAVHVVMYSYYGLSALGPAYQKYLWWKKYLTSLQLVQFVIVAIHISQFFFMEDCKYQFPVFACIIMSYSFMFLLLFLHFWYRAYTKGQRLPKTVKNGTCKNKDN",
"length": 281,
"molWeight": 33356,
"crc64": "33C3DA79704F6E9F",
"md5": "8BE30446BA90DCE3DA3A4ED115206E19"
} |
A1Y9I9 | This is Transmembrane O-methyltransferase homolog protein, from Mouse, contains 258 amino acids, is soluble, locates in Cytoplasm. | [] | {
"primaryAccession": "A1Y9I9",
"organism_name": "Mouse",
"protein_name": "Transmembrane O-methyltransferase homolog",
"length": 258,
"firstPublicDate": "2008-12-16T00:00:00",
"FUNCTION": "Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones (PubMed:18794526), Required for auditory function (PubMed:18794526, PubMed:28504928), Component of the cochlear hair cell's mechanotransduction (MET) machinery, Involved in the assembly of the asymmetric tip-link MET complex, Required for transportation of TMC1 and TMC2 proteins into the mechanically sensitive stereocilia of the hair cells, The function in MET is independent of the enzymatic activity (PubMed:28504928)",
"SUBCELLULAR LOCATION": "Cytoplasm",
"SIMILARITY": "Belongs to the class I-like SAM-binding methyltransferase superfamily, Cation-dependent O-methyltransferase family",
"domain_description": {
"C2H2-type Zinc finger": null,
"C2H2-type; degenerate Zinc finger": null,
"Ig-like V-type Immunoglobulin domain": null,
"RING-type; degenerate Zinc finger": null,
"BED-type Zinc finger": null,
"Ig-like C2-type Immunoglobulin domain": null,
"C5HC2 Zinc finger": null,
"C2H2-type 2; degenerate Zinc finger": null,
"C2H2-type 5; degenerate Zinc finger": null,
"DBF4-type Zinc finger": null,
"RING-CH-type Zinc finger": null,
"NR C4-type Zinc finger": null,
"SP-RING-type Zinc finger": null,
"RING-type Zinc finger": null,
"UBZ4-type Zinc finger": null,
"Ig-like C1-type Immunoglobulin domain": null,
"C2HC MYST-type Zinc finger": null,
"RanBP2-type Zinc finger": null,
"Ig-like Immunoglobulin domain": null,
"C3H1-type Zinc finger": null,
"C4-type Zinc finger": null,
"CCHC-type Zinc finger": null,
"RING-type; atypical Zinc finger": null,
"TFIIS-type Zinc finger": null,
"C2H2-type 2; atypical Zinc finger": null,
"RRN7-type Zinc finger": null,
"C2H2-type 1; degenerate Zinc finger": null,
"GATA-type Zinc finger": null,
" Zinc finger": null,
"Phorbol-ester/DAG-type Zinc finger": null,
"CR-type Zinc finger": null,
"GATA-type; atypical Zinc finger": null,
"PHD-type; atypical Zinc finger": null,
"C2H2-type 4; atypical Zinc finger": null,
"B box-type; degenerate Zinc finger": null,
"CCHHC-type Zinc finger": null,
"C2H2-type; atypical Zinc finger": null,
"PHD-type Zinc finger": null,
"SGF11-type Zinc finger": null,
"HIT-type Zinc finger": null,
"C2H2-type 4; degenerate Zinc finger": null,
"FYVE-type; atypical Zinc finger": null,
"FCS-type Zinc finger": null,
"RING-Gid-type Zinc finger": null,
"B box-type 1; atypical Zinc finger": null,
"B box-type Zinc finger": null,
"DNL-type Zinc finger": null,
"CCHH-type Zinc finger": null,
"ZZ-type; degenerate Zinc finger": null,
"C2H2-type 11; degenerate Zinc finger": null,
"UBZ3-type Zinc finger": null,
"PHD-type 2; atypical Zinc finger": null,
"Matrin-type Zinc finger": null,
"MYND-type Zinc finger": null,
"B box-type 2; atypical Zinc finger": null,
"C2H2-type 1; atypical Zinc finger": null,
"TAZ-type Zinc finger": null,
"CHHC U11-48K-type Zinc finger": null,
"UBZ2-type Zinc finger": null,
"C2HC pre-PHD-type Zinc finger": null,
"PHD-type; degenerate Zinc finger": null,
"C2H2-type 3; atypical Zinc finger": null,
"FYVE-type 1; atypical Zinc finger": null,
"FYVE-type Zinc finger": null,
"PARP-type Zinc finger": null,
"Btk-type Zinc finger": null,
"CCHC-type 2; atypical Zinc finger": null,
"ZZ-type Zinc finger": null,
"PHD-type 2; degenerate Zinc finger": null,
"UBP-type; degenerate Zinc finger": null,
"THAP-type Zinc finger": null,
"3CxxC-type Zinc finger": null,
"C2H2-type 6; degenerate Zinc finger": null,
"C2H2-type 7; degenerate Zinc finger": null,
"C2H2-type 9; degenerate Zinc finger": null,
"C2H2-type 6; atypical Zinc finger": null,
"RTR1-type Zinc finger": null,
"CW-type Zinc finger": null,
"FLYWCH-type Zinc finger": null,
"C2H2-type 3; degenerate Zinc finger": null,
"C3HC-type Zinc finger": null,
"CCHHC-type; degenerate Zinc finger": null,
"UBP-type Zinc finger": null,
"UBZ1-type Zinc finger": null,
"B box-type; atypical Zinc finger": null,
"FPG-type Zinc finger": null,
"Dof-type Zinc finger": null,
"ZF-HD dimerization-type; degenerate Zinc finger": null,
"NF-X1-type Zinc finger": null,
"SWIM-type Zinc finger": null,
"C2H2-type 10; degenerate Zinc finger": null,
"C2H2-type 14; degenerate Zinc finger": null,
"CXXC-type Zinc finger": null,
"TFIIB-type Zinc finger": null,
"NOB1 Zinc finger": null,
"C2H2 AKAP95-type Zinc finger": null,
"A20-type Zinc finger": null,
"AN1-type Zinc finger": null,
"MYND-type; atypical Zinc finger": null,
"RING-type 1; atypical Zinc finger": null,
"RING-type 2; atypical Zinc finger": null,
"SIAH-type Zinc finger": null,
"MYND-type; degenerate Zinc finger": null,
"C2H2-type 11; atypical Zinc finger": null
},
"bin_loc": "S",
"split": "train"
} | {
"value": "MSPAIALAFLPLVVTLLVRYRHHFRLLVRTVLLRGFRDCLSGLRIEERAFSYVLTHALPGDPGHILTTLDHWSSCCEYLSHMGPVKGQILMRLVEEKAPACVLELGTYCGYSTLLIARALPPGSRLLTVERDSRTAAVAEKVIRLAGFDEQMVELIAGSSEEVIPRLRAQHQLNRADLVLLAHRPRYYLRDLQLLEAHALLPHGATVLADHVLFPGAPRFLQYTKSCGRYRCRLHHTSLPDFPAIKDGIAQLTYTGPG",
"length": 258,
"molWeight": 28846,
"crc64": "393954F017C67E0C",
"md5": "3168C8D3485D5449525BBD71A6DA48CD"
} |
A1YKT1 | This is Transcription factor TCP18 protein, from Mouse-ear cress, contains 433 amino acids, locates in Nucleus. | [] | {
"primaryAccession": "A1YKT1",
"organism_name": "Mouse-ear cress",
"protein_name": "Transcription factor TCP18",
"length": 433,
"firstPublicDate": "2008-04-29T00:00:00",
"FUNCTION": "Transcription factor that prevents axillary bud outgrowth and delays early axillary bud development, Indirectly required for the auxin-induced control of apical dominance",
"SUBCELLULAR LOCATION": "Nucleus",
"SIMILARITY": null,
"domain_description": {
"C2H2-type Zinc finger": null,
"C2H2-type; degenerate Zinc finger": null,
"Ig-like V-type Immunoglobulin domain": null,
"RING-type; degenerate Zinc finger": null,
"BED-type Zinc finger": null,
"Ig-like C2-type Immunoglobulin domain": null,
"C5HC2 Zinc finger": null,
"C2H2-type 2; degenerate Zinc finger": null,
"C2H2-type 5; degenerate Zinc finger": null,
"DBF4-type Zinc finger": null,
"RING-CH-type Zinc finger": null,
"NR C4-type Zinc finger": null,
"SP-RING-type Zinc finger": null,
"RING-type Zinc finger": null,
"UBZ4-type Zinc finger": null,
"Ig-like C1-type Immunoglobulin domain": null,
"C2HC MYST-type Zinc finger": null,
"RanBP2-type Zinc finger": null,
"Ig-like Immunoglobulin domain": null,
"C3H1-type Zinc finger": null,
"C4-type Zinc finger": null,
"CCHC-type Zinc finger": null,
"RING-type; atypical Zinc finger": null,
"TFIIS-type Zinc finger": null,
"C2H2-type 2; atypical Zinc finger": null,
"RRN7-type Zinc finger": null,
"C2H2-type 1; degenerate Zinc finger": null,
"GATA-type Zinc finger": null,
" Zinc finger": null,
"Phorbol-ester/DAG-type Zinc finger": null,
"CR-type Zinc finger": null,
"GATA-type; atypical Zinc finger": null,
"PHD-type; atypical Zinc finger": null,
"C2H2-type 4; atypical Zinc finger": null,
"B box-type; degenerate Zinc finger": null,
"CCHHC-type Zinc finger": null,
"C2H2-type; atypical Zinc finger": null,
"PHD-type Zinc finger": null,
"SGF11-type Zinc finger": null,
"HIT-type Zinc finger": null,
"C2H2-type 4; degenerate Zinc finger": null,
"FYVE-type; atypical Zinc finger": null,
"FCS-type Zinc finger": null,
"RING-Gid-type Zinc finger": null,
"B box-type 1; atypical Zinc finger": null,
"B box-type Zinc finger": null,
"DNL-type Zinc finger": null,
"CCHH-type Zinc finger": null,
"ZZ-type; degenerate Zinc finger": null,
"C2H2-type 11; degenerate Zinc finger": null,
"UBZ3-type Zinc finger": null,
"PHD-type 2; atypical Zinc finger": null,
"Matrin-type Zinc finger": null,
"MYND-type Zinc finger": null,
"B box-type 2; atypical Zinc finger": null,
"C2H2-type 1; atypical Zinc finger": null,
"TAZ-type Zinc finger": null,
"CHHC U11-48K-type Zinc finger": null,
"UBZ2-type Zinc finger": null,
"C2HC pre-PHD-type Zinc finger": null,
"PHD-type; degenerate Zinc finger": null,
"C2H2-type 3; atypical Zinc finger": null,
"FYVE-type 1; atypical Zinc finger": null,
"FYVE-type Zinc finger": null,
"PARP-type Zinc finger": null,
"Btk-type Zinc finger": null,
"CCHC-type 2; atypical Zinc finger": null,
"ZZ-type Zinc finger": null,
"PHD-type 2; degenerate Zinc finger": null,
"UBP-type; degenerate Zinc finger": null,
"THAP-type Zinc finger": null,
"3CxxC-type Zinc finger": null,
"C2H2-type 6; degenerate Zinc finger": null,
"C2H2-type 7; degenerate Zinc finger": null,
"C2H2-type 9; degenerate Zinc finger": null,
"C2H2-type 6; atypical Zinc finger": null,
"RTR1-type Zinc finger": null,
"CW-type Zinc finger": null,
"FLYWCH-type Zinc finger": null,
"C2H2-type 3; degenerate Zinc finger": null,
"C3HC-type Zinc finger": null,
"CCHHC-type; degenerate Zinc finger": null,
"UBP-type Zinc finger": null,
"UBZ1-type Zinc finger": null,
"B box-type; atypical Zinc finger": null,
"FPG-type Zinc finger": null,
"Dof-type Zinc finger": null,
"ZF-HD dimerization-type; degenerate Zinc finger": null,
"NF-X1-type Zinc finger": null,
"SWIM-type Zinc finger": null,
"C2H2-type 10; degenerate Zinc finger": null,
"C2H2-type 14; degenerate Zinc finger": null,
"CXXC-type Zinc finger": null,
"TFIIB-type Zinc finger": null,
"NOB1 Zinc finger": null,
"C2H2 AKAP95-type Zinc finger": null,
"A20-type Zinc finger": null,
"AN1-type Zinc finger": null,
"MYND-type; atypical Zinc finger": null,
"RING-type 1; atypical Zinc finger": null,
"RING-type 2; atypical Zinc finger": null,
"SIAH-type Zinc finger": null,
"MYND-type; degenerate Zinc finger": null,
"C2H2-type 11; atypical Zinc finger": null
},
"bin_loc": "U",
"split": "train"
} | {
"value": "MNNNIFSTTTTINDDYMLFPYNDHYSSQPLLPFSPSSSINDILIHSTSNTSNNHLDHHHQFQQPSPFSHFEFAPDCALLTSFHPENNGHDDNQTIPNDNHHPSLHFPLNNTIVEQPTEPSETINLIEDSQRISTSQDPKMKKAKKPSRTDRHSKIKTAKGTRDRRMRLSLDVAKELFGLQDMLGFDKASKTVEWLLTQAKPEIIKIATTLSHHGCFSSGDESHIRPVLGSMDTSSDLCELASMWTVDDRGSNTNTTETRGNKVDGRSMRGKRKRPEPRTPILKKLSKEERAKARERAKGRTMEKMMMKMKGRSQLVKVVEEDAHDHGEIIKNNNRSQVNRSSFEMTHCEDKIEELCKNDRFAVCNEFIMNKKDHISNESYDLVNYKPNSSFPVINHHRSQGAANSIEQHQFTDLHYSFGAKPRDLMHNYQNMY",
"length": 433,
"molWeight": 49676,
"crc64": "E472DD229CAFBC1B",
"md5": "1154D680C9BB26EEB62C772A80C9EBF1"
} |
A1Z8N1 | This is Facilitated trehalose transporter Tret1-1 protein, from Fruit fly, contains 857 amino acids, is membrane-bound, locates in Cell membrane. | [] | {
"primaryAccession": "A1Z8N1",
"organism_name": "Fruit fly",
"protein_name": "Facilitated trehalose transporter Tret1-1",
"length": 857,
"firstPublicDate": "2010-07-13T00:00:00",
"FUNCTION": "Low-capacity facilitative transporter for trehalose, Does not transport maltose, sucrose or lactose, Mediates the bidirectional transfer of trehalose, Responsible for the transport of trehalose synthesized in the fat body and the incorporation of trehalose into other tissues that require a carbon source, thereby regulating trehalose levels in the hemolymph",
"SUBCELLULAR LOCATION": "Cell membrane",
"SIMILARITY": "Belongs to the major facilitator superfamily, Sugar transporter (TC 2,A,1,1) family, Trehalose transporter subfamily",
"domain_description": {
"C2H2-type Zinc finger": null,
"C2H2-type; degenerate Zinc finger": null,
"Ig-like V-type Immunoglobulin domain": null,
"RING-type; degenerate Zinc finger": null,
"BED-type Zinc finger": null,
"Ig-like C2-type Immunoglobulin domain": null,
"C5HC2 Zinc finger": null,
"C2H2-type 2; degenerate Zinc finger": null,
"C2H2-type 5; degenerate Zinc finger": null,
"DBF4-type Zinc finger": null,
"RING-CH-type Zinc finger": null,
"NR C4-type Zinc finger": null,
"SP-RING-type Zinc finger": null,
"RING-type Zinc finger": null,
"UBZ4-type Zinc finger": null,
"Ig-like C1-type Immunoglobulin domain": null,
"C2HC MYST-type Zinc finger": null,
"RanBP2-type Zinc finger": null,
"Ig-like Immunoglobulin domain": null,
"C3H1-type Zinc finger": null,
"C4-type Zinc finger": null,
"CCHC-type Zinc finger": null,
"RING-type; atypical Zinc finger": null,
"TFIIS-type Zinc finger": null,
"C2H2-type 2; atypical Zinc finger": null,
"RRN7-type Zinc finger": null,
"C2H2-type 1; degenerate Zinc finger": null,
"GATA-type Zinc finger": null,
" Zinc finger": null,
"Phorbol-ester/DAG-type Zinc finger": null,
"CR-type Zinc finger": null,
"GATA-type; atypical Zinc finger": null,
"PHD-type; atypical Zinc finger": null,
"C2H2-type 4; atypical Zinc finger": null,
"B box-type; degenerate Zinc finger": null,
"CCHHC-type Zinc finger": null,
"C2H2-type; atypical Zinc finger": null,
"PHD-type Zinc finger": null,
"SGF11-type Zinc finger": null,
"HIT-type Zinc finger": null,
"C2H2-type 4; degenerate Zinc finger": null,
"FYVE-type; atypical Zinc finger": null,
"FCS-type Zinc finger": null,
"RING-Gid-type Zinc finger": null,
"B box-type 1; atypical Zinc finger": null,
"B box-type Zinc finger": null,
"DNL-type Zinc finger": null,
"CCHH-type Zinc finger": null,
"ZZ-type; degenerate Zinc finger": null,
"C2H2-type 11; degenerate Zinc finger": null,
"UBZ3-type Zinc finger": null,
"PHD-type 2; atypical Zinc finger": null,
"Matrin-type Zinc finger": null,
"MYND-type Zinc finger": null,
"B box-type 2; atypical Zinc finger": null,
"C2H2-type 1; atypical Zinc finger": null,
"TAZ-type Zinc finger": null,
"CHHC U11-48K-type Zinc finger": null,
"UBZ2-type Zinc finger": null,
"C2HC pre-PHD-type Zinc finger": null,
"PHD-type; degenerate Zinc finger": null,
"C2H2-type 3; atypical Zinc finger": null,
"FYVE-type 1; atypical Zinc finger": null,
"FYVE-type Zinc finger": null,
"PARP-type Zinc finger": null,
"Btk-type Zinc finger": null,
"CCHC-type 2; atypical Zinc finger": null,
"ZZ-type Zinc finger": null,
"PHD-type 2; degenerate Zinc finger": null,
"UBP-type; degenerate Zinc finger": null,
"THAP-type Zinc finger": null,
"3CxxC-type Zinc finger": null,
"C2H2-type 6; degenerate Zinc finger": null,
"C2H2-type 7; degenerate Zinc finger": null,
"C2H2-type 9; degenerate Zinc finger": null,
"C2H2-type 6; atypical Zinc finger": null,
"RTR1-type Zinc finger": null,
"CW-type Zinc finger": null,
"FLYWCH-type Zinc finger": null,
"C2H2-type 3; degenerate Zinc finger": null,
"C3HC-type Zinc finger": null,
"CCHHC-type; degenerate Zinc finger": null,
"UBP-type Zinc finger": null,
"UBZ1-type Zinc finger": null,
"B box-type; atypical Zinc finger": null,
"FPG-type Zinc finger": null,
"Dof-type Zinc finger": null,
"ZF-HD dimerization-type; degenerate Zinc finger": null,
"NF-X1-type Zinc finger": null,
"SWIM-type Zinc finger": null,
"C2H2-type 10; degenerate Zinc finger": null,
"C2H2-type 14; degenerate Zinc finger": null,
"CXXC-type Zinc finger": null,
"TFIIB-type Zinc finger": null,
"NOB1 Zinc finger": null,
"C2H2 AKAP95-type Zinc finger": null,
"A20-type Zinc finger": null,
"AN1-type Zinc finger": null,
"MYND-type; atypical Zinc finger": null,
"RING-type 1; atypical Zinc finger": null,
"RING-type 2; atypical Zinc finger": null,
"SIAH-type Zinc finger": null,
"MYND-type; degenerate Zinc finger": null,
"C2H2-type 11; atypical Zinc finger": null
},
"bin_loc": "M",
"split": "train"
} | {
"value": "MSGRDNRGAGGGGGGHQPLSNAMGKLKEKLTRVGDELGYHRVESNLSTSNTATSLDTILPEDPFLFPQVSPQRHPQNTVRTQRLLEDEPPLSFRPLLEDDDINEPPTQQQQRTPLRASGSLELTPLPPPPTSLEIREHRDRQQRGAQGDELQRSKQSLKGSRVSFERRDTGNSNTNSNKAAESSDEDSFEEKRTGFQQQKATSVDHKGILKDLKHILANDNRRQFQAKKHVSLDVKGTRFLQDLLKESSSEEEFHKTRREFQGRKHQSLDPRVTFKLDKVLQGSSTDSDEEGEDAEHKRLIHRPKDITKPVIIDLKDLESESDEDFLTSRQHFQQQRSISTDSRKSRRLYEMDEMDNKRGENIRHAVPFVRQITEDGKPKLEVYRPTTNPIYIWTQVLAALSVSLGSLVVGFVSAYTSPALVSMTDRNITSFEVTQDAGSWVGGIMPLAGLAGGIAGGPLIEYLGRRNTILATAVPFIVSSLLIACAVNVAMVLCGRFLAGFCVGIASLSLPVYLGETVQPEVRGTLGLLPTAFGNIGILLCFVAGSFMNWSMLAFLGAALPVPFLILMFLIPETPRWFVGRGLEERARKALKWLRGKEADVEPELKGLMRSQADADRQASRNTMLELLKLNNLKPLSISLGLMFFQQFSGINAVIFYTVQIFKDAGSTIDGNLCTIIVGIVNFLATFIGIVLIDRAGRKILLYVSDIAMVLTLFVLGGFFYCKTYGPDVSHLGWLPLTCFVIYILGFSLGFGPIPWLMMGEILPAKIRGSAASVATAFNWFCTFVVTKTFQDLTVAMGAHGAFWLFGAICFVGLFFVIIYVPETQGKTLEDIERKMMGRVRRMSSVANIKPLSFNM",
"length": 857,
"molWeight": 95188,
"crc64": "8408E1191B8B7A5F",
"md5": "92CA50864967AD59D1C3D80835977F70"
} |
A2AG06 | This is Meiosis-specific coiled-coil domain-containing protein MEIOC protein, from Mouse, contains 965 amino acids, is soluble, locates in Cytoplasm. | [] | {
"primaryAccession": "A2AG06",
"organism_name": "Mouse",
"protein_name": "Meiosis-specific coiled-coil domain-containing protein MEIOC",
"length": 965,
"firstPublicDate": "2010-04-20T00:00:00",
"FUNCTION": "Is required for meiosis completion in both male and female germ cells, Confers stability to numerous meiotic mRNAs in gonads allowing proper initiation and progression into meiosis prophase I, The function may involve YTHDC2 and is independent of induction by retinoic acid (RA), Maintains an extended meiotic prophase I by properly promoting the transition from a mitotic to a meiotic cell cycle program by binding transcripts through its interaction with YTHDC2 that regulate the mitotic cell cycle (PubMed:28380054)",
"SUBCELLULAR LOCATION": "Cytoplasm",
"SIMILARITY": null,
"domain_description": {
"C2H2-type Zinc finger": null,
"C2H2-type; degenerate Zinc finger": null,
"Ig-like V-type Immunoglobulin domain": null,
"RING-type; degenerate Zinc finger": null,
"BED-type Zinc finger": null,
"Ig-like C2-type Immunoglobulin domain": null,
"C5HC2 Zinc finger": null,
"C2H2-type 2; degenerate Zinc finger": null,
"C2H2-type 5; degenerate Zinc finger": null,
"DBF4-type Zinc finger": null,
"RING-CH-type Zinc finger": null,
"NR C4-type Zinc finger": null,
"SP-RING-type Zinc finger": null,
"RING-type Zinc finger": null,
"UBZ4-type Zinc finger": null,
"Ig-like C1-type Immunoglobulin domain": null,
"C2HC MYST-type Zinc finger": null,
"RanBP2-type Zinc finger": null,
"Ig-like Immunoglobulin domain": null,
"C3H1-type Zinc finger": null,
"C4-type Zinc finger": null,
"CCHC-type Zinc finger": null,
"RING-type; atypical Zinc finger": null,
"TFIIS-type Zinc finger": null,
"C2H2-type 2; atypical Zinc finger": null,
"RRN7-type Zinc finger": null,
"C2H2-type 1; degenerate Zinc finger": null,
"GATA-type Zinc finger": null,
" Zinc finger": null,
"Phorbol-ester/DAG-type Zinc finger": null,
"CR-type Zinc finger": null,
"GATA-type; atypical Zinc finger": null,
"PHD-type; atypical Zinc finger": null,
"C2H2-type 4; atypical Zinc finger": null,
"B box-type; degenerate Zinc finger": null,
"CCHHC-type Zinc finger": null,
"C2H2-type; atypical Zinc finger": null,
"PHD-type Zinc finger": null,
"SGF11-type Zinc finger": null,
"HIT-type Zinc finger": null,
"C2H2-type 4; degenerate Zinc finger": null,
"FYVE-type; atypical Zinc finger": null,
"FCS-type Zinc finger": null,
"RING-Gid-type Zinc finger": null,
"B box-type 1; atypical Zinc finger": null,
"B box-type Zinc finger": null,
"DNL-type Zinc finger": null,
"CCHH-type Zinc finger": null,
"ZZ-type; degenerate Zinc finger": null,
"C2H2-type 11; degenerate Zinc finger": null,
"UBZ3-type Zinc finger": null,
"PHD-type 2; atypical Zinc finger": null,
"Matrin-type Zinc finger": null,
"MYND-type Zinc finger": null,
"B box-type 2; atypical Zinc finger": null,
"C2H2-type 1; atypical Zinc finger": null,
"TAZ-type Zinc finger": null,
"CHHC U11-48K-type Zinc finger": null,
"UBZ2-type Zinc finger": null,
"C2HC pre-PHD-type Zinc finger": null,
"PHD-type; degenerate Zinc finger": null,
"C2H2-type 3; atypical Zinc finger": null,
"FYVE-type 1; atypical Zinc finger": null,
"FYVE-type Zinc finger": null,
"PARP-type Zinc finger": null,
"Btk-type Zinc finger": null,
"CCHC-type 2; atypical Zinc finger": null,
"ZZ-type Zinc finger": null,
"PHD-type 2; degenerate Zinc finger": null,
"UBP-type; degenerate Zinc finger": null,
"THAP-type Zinc finger": null,
"3CxxC-type Zinc finger": null,
"C2H2-type 6; degenerate Zinc finger": null,
"C2H2-type 7; degenerate Zinc finger": null,
"C2H2-type 9; degenerate Zinc finger": null,
"C2H2-type 6; atypical Zinc finger": null,
"RTR1-type Zinc finger": null,
"CW-type Zinc finger": null,
"FLYWCH-type Zinc finger": null,
"C2H2-type 3; degenerate Zinc finger": null,
"C3HC-type Zinc finger": null,
"CCHHC-type; degenerate Zinc finger": null,
"UBP-type Zinc finger": null,
"UBZ1-type Zinc finger": null,
"B box-type; atypical Zinc finger": null,
"FPG-type Zinc finger": null,
"Dof-type Zinc finger": null,
"ZF-HD dimerization-type; degenerate Zinc finger": null,
"NF-X1-type Zinc finger": null,
"SWIM-type Zinc finger": null,
"C2H2-type 10; degenerate Zinc finger": null,
"C2H2-type 14; degenerate Zinc finger": null,
"CXXC-type Zinc finger": null,
"TFIIB-type Zinc finger": null,
"NOB1 Zinc finger": null,
"C2H2 AKAP95-type Zinc finger": null,
"A20-type Zinc finger": null,
"AN1-type Zinc finger": null,
"MYND-type; atypical Zinc finger": null,
"RING-type 1; atypical Zinc finger": null,
"RING-type 2; atypical Zinc finger": null,
"SIAH-type Zinc finger": null,
"MYND-type; degenerate Zinc finger": null,
"C2H2-type 11; atypical Zinc finger": null
},
"bin_loc": "S",
"split": "train"
} | {
"value": "MEVSGGDTCRPRHPQGLREGPEPKVAAAAAAFRGSANRCWNLSVDTSNRLSDVFNSMMLTGSAPFYDCYKSQNEDNVDLRQTCTPLSSSTEYASSIDSSLFYAPWSTYGDDIKQPPSSQISVKNRIQTERNDYGSETDLYGLVSNILEEQDKSQPYFAEGTCSSNLKSVWPMNTSRFVDHHDLLTEPKRPVDTSISQQAFYSGESVSAVEKQYLHNSSLTPQQKIDELYHGYTGLDLEEQWLYLSRSDHSNCYNSQANDTVKATFQEYPFVKNCFTPQTGLSDIMKESGIDTYAYGREKICTKGLETPLQHKRAEIFLSQFNRYNENADYCRYPEYAHPNKAKLNKCSNFSVQDGKKLANGTPETPTVEADAYTKLFQVKPANQKKMEETIPDQQNFAFPKTTPHLTEKQFAKEAAFTADFGLKSEYGLKPHTACPTNNDFANVSEKQQFAKPDPLNSEYFKSVNLFSNSATSSGGISLNRPTWMNVQTKNNLPIPYRNQGNLMKLNSHLSAASKGSNHSSDFPQLSSTNLTSNSNLFQKYCQENPSAFSSFDFSYNGAERIQSVNHMEGLTKTGEDNLFESVTEKKIKQPNGFCDSYSASQYGIIENVNKHNFQAKPQSGHYDPEDIPKHFDGLPQNTYQDLLESQGHFNSHRQGSGDNNINSRVNRTQASCFSNNYMMGDLRHNQGFQQLGSNGFPLRSTHPFGHSVVPLLDSYDLFSYDDLSHLYPYFNDMMYGDNSFSGFVPTFGFQRPIKTRSGPASELHIRLEECYEQWRALEKERKKTELALAKNYPGKKVSSTNNTPIPRLTSNPSRVDRLIVDELREQARVVTLLGKMERLRSSPLHANISTALDRHLESIHIVQSRRKDEIVNASNRQRQGVPRCQDDRDVFALATAIKEMCVATRKARTTLWCALQMTLPKTASTAGQADMEKAFQDLVNCEEKVHESINSSNPMNQRGETSKH",
"length": 965,
"molWeight": 108830,
"crc64": "D1DBA1EA7412DD62",
"md5": "5F1449AFFB3EEBC89C2FE9AE2CF089BD"
} |
A2AJB7 | This is Epididymal-specific lipocalin-5 protein, from Mouse, contains 192 amino acids, is soluble, locates in Extracellular. | [] | {
"primaryAccession": "A2AJB7",
"organism_name": "Mouse",
"protein_name": "Epididymal-specific lipocalin-5",
"length": 192,
"firstPublicDate": "2008-06-10T00:00:00",
"FUNCTION": "Associates with spermatozoa in the epididymal fluid but does not bind tightly to them, Binds both all-trans and 13-cis retinoic acid, May act as a retinoid carrier protein which is required for epididymal function and/or sperm maturation",
"SUBCELLULAR LOCATION": "Extracellular",
"SIMILARITY": "Belongs to the calycin superfamily, Lipocalin family",
"domain_description": {
"C2H2-type Zinc finger": null,
"C2H2-type; degenerate Zinc finger": null,
"Ig-like V-type Immunoglobulin domain": null,
"RING-type; degenerate Zinc finger": null,
"BED-type Zinc finger": null,
"Ig-like C2-type Immunoglobulin domain": null,
"C5HC2 Zinc finger": null,
"C2H2-type 2; degenerate Zinc finger": null,
"C2H2-type 5; degenerate Zinc finger": null,
"DBF4-type Zinc finger": null,
"RING-CH-type Zinc finger": null,
"NR C4-type Zinc finger": null,
"SP-RING-type Zinc finger": null,
"RING-type Zinc finger": null,
"UBZ4-type Zinc finger": null,
"Ig-like C1-type Immunoglobulin domain": null,
"C2HC MYST-type Zinc finger": null,
"RanBP2-type Zinc finger": null,
"Ig-like Immunoglobulin domain": null,
"C3H1-type Zinc finger": null,
"C4-type Zinc finger": null,
"CCHC-type Zinc finger": null,
"RING-type; atypical Zinc finger": null,
"TFIIS-type Zinc finger": null,
"C2H2-type 2; atypical Zinc finger": null,
"RRN7-type Zinc finger": null,
"C2H2-type 1; degenerate Zinc finger": null,
"GATA-type Zinc finger": null,
" Zinc finger": null,
"Phorbol-ester/DAG-type Zinc finger": null,
"CR-type Zinc finger": null,
"GATA-type; atypical Zinc finger": null,
"PHD-type; atypical Zinc finger": null,
"C2H2-type 4; atypical Zinc finger": null,
"B box-type; degenerate Zinc finger": null,
"CCHHC-type Zinc finger": null,
"C2H2-type; atypical Zinc finger": null,
"PHD-type Zinc finger": null,
"SGF11-type Zinc finger": null,
"HIT-type Zinc finger": null,
"C2H2-type 4; degenerate Zinc finger": null,
"FYVE-type; atypical Zinc finger": null,
"FCS-type Zinc finger": null,
"RING-Gid-type Zinc finger": null,
"B box-type 1; atypical Zinc finger": null,
"B box-type Zinc finger": null,
"DNL-type Zinc finger": null,
"CCHH-type Zinc finger": null,
"ZZ-type; degenerate Zinc finger": null,
"C2H2-type 11; degenerate Zinc finger": null,
"UBZ3-type Zinc finger": null,
"PHD-type 2; atypical Zinc finger": null,
"Matrin-type Zinc finger": null,
"MYND-type Zinc finger": null,
"B box-type 2; atypical Zinc finger": null,
"C2H2-type 1; atypical Zinc finger": null,
"TAZ-type Zinc finger": null,
"CHHC U11-48K-type Zinc finger": null,
"UBZ2-type Zinc finger": null,
"C2HC pre-PHD-type Zinc finger": null,
"PHD-type; degenerate Zinc finger": null,
"C2H2-type 3; atypical Zinc finger": null,
"FYVE-type 1; atypical Zinc finger": null,
"FYVE-type Zinc finger": null,
"PARP-type Zinc finger": null,
"Btk-type Zinc finger": null,
"CCHC-type 2; atypical Zinc finger": null,
"ZZ-type Zinc finger": null,
"PHD-type 2; degenerate Zinc finger": null,
"UBP-type; degenerate Zinc finger": null,
"THAP-type Zinc finger": null,
"3CxxC-type Zinc finger": null,
"C2H2-type 6; degenerate Zinc finger": null,
"C2H2-type 7; degenerate Zinc finger": null,
"C2H2-type 9; degenerate Zinc finger": null,
"C2H2-type 6; atypical Zinc finger": null,
"RTR1-type Zinc finger": null,
"CW-type Zinc finger": null,
"FLYWCH-type Zinc finger": null,
"C2H2-type 3; degenerate Zinc finger": null,
"C3HC-type Zinc finger": null,
"CCHHC-type; degenerate Zinc finger": null,
"UBP-type Zinc finger": null,
"UBZ1-type Zinc finger": null,
"B box-type; atypical Zinc finger": null,
"FPG-type Zinc finger": null,
"Dof-type Zinc finger": null,
"ZF-HD dimerization-type; degenerate Zinc finger": null,
"NF-X1-type Zinc finger": null,
"SWIM-type Zinc finger": null,
"C2H2-type 10; degenerate Zinc finger": null,
"C2H2-type 14; degenerate Zinc finger": null,
"CXXC-type Zinc finger": null,
"TFIIB-type Zinc finger": null,
"NOB1 Zinc finger": null,
"C2H2 AKAP95-type Zinc finger": null,
"A20-type Zinc finger": null,
"AN1-type Zinc finger": null,
"MYND-type; atypical Zinc finger": null,
"RING-type 1; atypical Zinc finger": null,
"RING-type 2; atypical Zinc finger": null,
"SIAH-type Zinc finger": null,
"MYND-type; degenerate Zinc finger": null,
"C2H2-type 11; atypical Zinc finger": null
},
"bin_loc": "S",
"split": "train"
} | {
"value": "MCSVARHMESIMLFTLLGLCVGLAAGTEAAVVKDFDVNKFLGFWYEIALASKMGAYGLAHKEEKMGAMVVELKENLLALTTTYYNEGHCVLEKVAATQVDGSAKYKVTRISGEKEVVVVATDYMTYTVIDITSLVAGAVHRAMKLYSRSLDNNGEALNNFQKIALKHGFSETDIHILKHDLTCVNALQSGQI",
"length": 192,
"molWeight": 21013,
"crc64": "E91DA019DEF21F5B",
"md5": "798EFB2F32EF28243A2C43AB5C4EE462"
} |
A2AKK5 | This is Acyl-coenzyme A amino acid N-acyltransferase 1 protein, from Mouse, contains 416 amino acids, locates in Peroxisome. | [] | {
"primaryAccession": "A2AKK5",
"organism_name": "Mouse",
"protein_name": "Acyl-coenzyme A amino acid N-acyltransferase 1",
"length": 416,
"firstPublicDate": "2008-10-14T00:00:00",
"FUNCTION": "Acyltransferase which efficiently conjugates very long-chain and long-chain fatty acids to taurine (PubMed:17116739), Shows no conjugation activity in the presence of glycine (PubMed:17116739)",
"SUBCELLULAR LOCATION": "Peroxisome",
"SIMILARITY": "Belongs to the C/M/P thioester hydrolase family",
"domain_description": {
"C2H2-type Zinc finger": null,
"C2H2-type; degenerate Zinc finger": null,
"Ig-like V-type Immunoglobulin domain": null,
"RING-type; degenerate Zinc finger": null,
"BED-type Zinc finger": null,
"Ig-like C2-type Immunoglobulin domain": null,
"C5HC2 Zinc finger": null,
"C2H2-type 2; degenerate Zinc finger": null,
"C2H2-type 5; degenerate Zinc finger": null,
"DBF4-type Zinc finger": null,
"RING-CH-type Zinc finger": null,
"NR C4-type Zinc finger": null,
"SP-RING-type Zinc finger": null,
"RING-type Zinc finger": null,
"UBZ4-type Zinc finger": null,
"Ig-like C1-type Immunoglobulin domain": null,
"C2HC MYST-type Zinc finger": null,
"RanBP2-type Zinc finger": null,
"Ig-like Immunoglobulin domain": null,
"C3H1-type Zinc finger": null,
"C4-type Zinc finger": null,
"CCHC-type Zinc finger": null,
"RING-type; atypical Zinc finger": null,
"TFIIS-type Zinc finger": null,
"C2H2-type 2; atypical Zinc finger": null,
"RRN7-type Zinc finger": null,
"C2H2-type 1; degenerate Zinc finger": null,
"GATA-type Zinc finger": null,
" Zinc finger": null,
"Phorbol-ester/DAG-type Zinc finger": null,
"CR-type Zinc finger": null,
"GATA-type; atypical Zinc finger": null,
"PHD-type; atypical Zinc finger": null,
"C2H2-type 4; atypical Zinc finger": null,
"B box-type; degenerate Zinc finger": null,
"CCHHC-type Zinc finger": null,
"C2H2-type; atypical Zinc finger": null,
"PHD-type Zinc finger": null,
"SGF11-type Zinc finger": null,
"HIT-type Zinc finger": null,
"C2H2-type 4; degenerate Zinc finger": null,
"FYVE-type; atypical Zinc finger": null,
"FCS-type Zinc finger": null,
"RING-Gid-type Zinc finger": null,
"B box-type 1; atypical Zinc finger": null,
"B box-type Zinc finger": null,
"DNL-type Zinc finger": null,
"CCHH-type Zinc finger": null,
"ZZ-type; degenerate Zinc finger": null,
"C2H2-type 11; degenerate Zinc finger": null,
"UBZ3-type Zinc finger": null,
"PHD-type 2; atypical Zinc finger": null,
"Matrin-type Zinc finger": null,
"MYND-type Zinc finger": null,
"B box-type 2; atypical Zinc finger": null,
"C2H2-type 1; atypical Zinc finger": null,
"TAZ-type Zinc finger": null,
"CHHC U11-48K-type Zinc finger": null,
"UBZ2-type Zinc finger": null,
"C2HC pre-PHD-type Zinc finger": null,
"PHD-type; degenerate Zinc finger": null,
"C2H2-type 3; atypical Zinc finger": null,
"FYVE-type 1; atypical Zinc finger": null,
"FYVE-type Zinc finger": null,
"PARP-type Zinc finger": null,
"Btk-type Zinc finger": null,
"CCHC-type 2; atypical Zinc finger": null,
"ZZ-type Zinc finger": null,
"PHD-type 2; degenerate Zinc finger": null,
"UBP-type; degenerate Zinc finger": null,
"THAP-type Zinc finger": null,
"3CxxC-type Zinc finger": null,
"C2H2-type 6; degenerate Zinc finger": null,
"C2H2-type 7; degenerate Zinc finger": null,
"C2H2-type 9; degenerate Zinc finger": null,
"C2H2-type 6; atypical Zinc finger": null,
"RTR1-type Zinc finger": null,
"CW-type Zinc finger": null,
"FLYWCH-type Zinc finger": null,
"C2H2-type 3; degenerate Zinc finger": null,
"C3HC-type Zinc finger": null,
"CCHHC-type; degenerate Zinc finger": null,
"UBP-type Zinc finger": null,
"UBZ1-type Zinc finger": null,
"B box-type; atypical Zinc finger": null,
"FPG-type Zinc finger": null,
"Dof-type Zinc finger": null,
"ZF-HD dimerization-type; degenerate Zinc finger": null,
"NF-X1-type Zinc finger": null,
"SWIM-type Zinc finger": null,
"C2H2-type 10; degenerate Zinc finger": null,
"C2H2-type 14; degenerate Zinc finger": null,
"CXXC-type Zinc finger": null,
"TFIIB-type Zinc finger": null,
"NOB1 Zinc finger": null,
"C2H2 AKAP95-type Zinc finger": null,
"A20-type Zinc finger": null,
"AN1-type Zinc finger": null,
"MYND-type; atypical Zinc finger": null,
"RING-type 1; atypical Zinc finger": null,
"RING-type 2; atypical Zinc finger": null,
"SIAH-type Zinc finger": null,
"MYND-type; degenerate Zinc finger": null,
"C2H2-type 11; atypical Zinc finger": null
},
"bin_loc": "U",
"split": "train"
} | {
"value": "MMIKLIATPSNALVDEPVSIRATGLPPSQIVTIKATVKDENDNVFQSQAFYKTNEAGEVDLEKTPALGGDYVGVHPMGLFFSLKPKKAFHRLMKKDVMNSPFCICLDLYDSVNWLETVRIPSKASQRVQRWFVGPGVKREQIQEGRVRGALFLPPGKGPFPGIIDLFGVIGGLVEFRASLLASHGFAVLALAYFAYKDLPEKLQEVDLEYFEEAANFLLSHPKIQQPGIGVISTSKGAEIGLAMACYLKQVIATVCINGATTTTAVPLRYQDLVVTPIQQALERMEVHVSGAVCFRHTTQYLQNKNILPVEKAQGKILFIVGENDELLDSKLHAQRAMDRLRRHGRSSGRMLAYPGAGHLIEPPYSPLCFASWQPVLGRPMCFGGDLMAHAAAQEHSWREIQKFFRKHLLQSGSKL",
"length": 416,
"molWeight": 46071,
"crc64": "EA313ED0782260F4",
"md5": "DB3231A737A5D77382E31B4A3A721959"
} |
A2AM29 | This is Protein AF-9 protein, from Mouse, contains 569 amino acids, locates in Nucleus. | [] | {
"primaryAccession": "A2AM29",
"organism_name": "Mouse",
"protein_name": "Protein AF-9",
"length": 569,
"firstPublicDate": "2007-10-02T00:00:00",
"FUNCTION": "Chromatin reader component of the super elongation complex (SEC), a complex required to increase the catalytic rate of RNA polymerase II transcription by suppressing transient pausing by the polymerase at multiple sites along the DNA, Specifically recognizes and binds acylated histone H3, with a preference for histone H3 that is crotonylated, Crotonylation marks active promoters and enhancers and confers resistance to transcriptional repressors, Recognizes and binds histone H3 crotonylated at 'Lys-9' (H3K9cr), and with slightly lower affinity histone H3 crotonylated at 'Lys-18' (H3K18cr), Also recognizes and binds histone H3 acetylated and butyrylated at 'Lys-9' (H3K9ac and H3K9bu, respectively), but with lower affinity than crotonylated histone H3, In the SEC complex, MLLT3 is required to recruit the complex to crotonylated histones, Recruitment of the SEC complex to crotonylated histones promotes recruitment of DOT1L on active chromatin to deposit histone H3 'Lys-79' methylation (H3K79me), Plays a key role in hematopoietic stem cell (HSC) maintenance by preserving, rather than confering, HSC stemness, Acts by binding to the transcription start site of active genes in HSCs and sustaining level of H3K79me2, probably by recruiting DOT1L",
"SUBCELLULAR LOCATION": "Nucleus",
"SIMILARITY": null,
"domain_description": {
"C2H2-type Zinc finger": null,
"C2H2-type; degenerate Zinc finger": null,
"Ig-like V-type Immunoglobulin domain": null,
"RING-type; degenerate Zinc finger": null,
"BED-type Zinc finger": null,
"Ig-like C2-type Immunoglobulin domain": null,
"C5HC2 Zinc finger": null,
"C2H2-type 2; degenerate Zinc finger": null,
"C2H2-type 5; degenerate Zinc finger": null,
"DBF4-type Zinc finger": null,
"RING-CH-type Zinc finger": null,
"NR C4-type Zinc finger": null,
"SP-RING-type Zinc finger": null,
"RING-type Zinc finger": null,
"UBZ4-type Zinc finger": null,
"Ig-like C1-type Immunoglobulin domain": null,
"C2HC MYST-type Zinc finger": null,
"RanBP2-type Zinc finger": null,
"Ig-like Immunoglobulin domain": null,
"C3H1-type Zinc finger": null,
"C4-type Zinc finger": null,
"CCHC-type Zinc finger": null,
"RING-type; atypical Zinc finger": null,
"TFIIS-type Zinc finger": null,
"C2H2-type 2; atypical Zinc finger": null,
"RRN7-type Zinc finger": null,
"C2H2-type 1; degenerate Zinc finger": null,
"GATA-type Zinc finger": null,
" Zinc finger": null,
"Phorbol-ester/DAG-type Zinc finger": null,
"CR-type Zinc finger": null,
"GATA-type; atypical Zinc finger": null,
"PHD-type; atypical Zinc finger": null,
"C2H2-type 4; atypical Zinc finger": null,
"B box-type; degenerate Zinc finger": null,
"CCHHC-type Zinc finger": null,
"C2H2-type; atypical Zinc finger": null,
"PHD-type Zinc finger": null,
"SGF11-type Zinc finger": null,
"HIT-type Zinc finger": null,
"C2H2-type 4; degenerate Zinc finger": null,
"FYVE-type; atypical Zinc finger": null,
"FCS-type Zinc finger": null,
"RING-Gid-type Zinc finger": null,
"B box-type 1; atypical Zinc finger": null,
"B box-type Zinc finger": null,
"DNL-type Zinc finger": null,
"CCHH-type Zinc finger": null,
"ZZ-type; degenerate Zinc finger": null,
"C2H2-type 11; degenerate Zinc finger": null,
"UBZ3-type Zinc finger": null,
"PHD-type 2; atypical Zinc finger": null,
"Matrin-type Zinc finger": null,
"MYND-type Zinc finger": null,
"B box-type 2; atypical Zinc finger": null,
"C2H2-type 1; atypical Zinc finger": null,
"TAZ-type Zinc finger": null,
"CHHC U11-48K-type Zinc finger": null,
"UBZ2-type Zinc finger": null,
"C2HC pre-PHD-type Zinc finger": null,
"PHD-type; degenerate Zinc finger": null,
"C2H2-type 3; atypical Zinc finger": null,
"FYVE-type 1; atypical Zinc finger": null,
"FYVE-type Zinc finger": null,
"PARP-type Zinc finger": null,
"Btk-type Zinc finger": null,
"CCHC-type 2; atypical Zinc finger": null,
"ZZ-type Zinc finger": null,
"PHD-type 2; degenerate Zinc finger": null,
"UBP-type; degenerate Zinc finger": null,
"THAP-type Zinc finger": null,
"3CxxC-type Zinc finger": null,
"C2H2-type 6; degenerate Zinc finger": null,
"C2H2-type 7; degenerate Zinc finger": null,
"C2H2-type 9; degenerate Zinc finger": null,
"C2H2-type 6; atypical Zinc finger": null,
"RTR1-type Zinc finger": null,
"CW-type Zinc finger": null,
"FLYWCH-type Zinc finger": null,
"C2H2-type 3; degenerate Zinc finger": null,
"C3HC-type Zinc finger": null,
"CCHHC-type; degenerate Zinc finger": null,
"UBP-type Zinc finger": null,
"UBZ1-type Zinc finger": null,
"B box-type; atypical Zinc finger": null,
"FPG-type Zinc finger": null,
"Dof-type Zinc finger": null,
"ZF-HD dimerization-type; degenerate Zinc finger": null,
"NF-X1-type Zinc finger": null,
"SWIM-type Zinc finger": null,
"C2H2-type 10; degenerate Zinc finger": null,
"C2H2-type 14; degenerate Zinc finger": null,
"CXXC-type Zinc finger": null,
"TFIIB-type Zinc finger": null,
"NOB1 Zinc finger": null,
"C2H2 AKAP95-type Zinc finger": null,
"A20-type Zinc finger": null,
"AN1-type Zinc finger": null,
"MYND-type; atypical Zinc finger": null,
"RING-type 1; atypical Zinc finger": null,
"RING-type 2; atypical Zinc finger": null,
"SIAH-type Zinc finger": null,
"MYND-type; degenerate Zinc finger": null,
"C2H2-type 11; atypical Zinc finger": null
},
"bin_loc": "U",
"split": "train"
} | {
"value": "MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPKKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKAGGDPNRSIHTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSFSKPHKLMKEHKEKPSKDSREHKSAFKEPSRDHNKSSKDSSKKPKENKPLKEEKIVPKMAFKEPKPMSKEPKADSNLLTVTSGQQDKKAPSKRPPASDSEELSAKKRKKSSSEALFKSFSSAPPLILTCSADKKQIKDKSHVKMGKVKIESETSEKKKSMLPPFDDIVDPNDSDVEENMSSKSDSEQPSPASSSSSSSSSFTPSQTRQQGPLRSIMKDLHSDDNEEESDEAEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILEVKSPIKQSKSDKQIKNGECDKAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQSYLETSGTS",
"length": 569,
"molWeight": 63375,
"crc64": "120A0604B13675EC",
"md5": "829F2EAE805B82232FD98DE7D7927F3E"
} |
A2ARI4 | This is Leucine-rich repeat-containing G-protein coupled receptor 4 protein, from Mouse, contains 951 amino acids, is membrane-bound, locates in Cell membrane. | [] | {
"primaryAccession": "A2ARI4",
"organism_name": "Mouse",
"protein_name": "Leucine-rich repeat-containing G-protein coupled receptor 4",
"length": 951,
"firstPublicDate": "2007-09-11T00:00:00",
"FUNCTION": "Receptor for R-spondins that potentiates the canonical Wnt signaling pathway and is involved in the formation of various organs, Upon binding to R-spondins (RSPO1, RSPO2, RSPO3 or RSPO4), associates with phosphorylated LRP6 and frizzled receptors that are activated by extracellular Wnt receptors, triggering the canonical Wnt signaling pathway to increase expression of target genes, In contrast to classical G-protein coupled receptors, does not activate heterotrimeric G-proteins to transduce the signal, Its function as activator of the Wnt signaling pathway is required for the development of various organs, including liver, kidney, intestine, bone, reproductive tract and eye, May also act as a receptor for norrin (NDP), such results however require additional confirmation in vivo, Required during spermatogenesis to activate the Wnt signaling pathway in peritubular myoid cells, Required for the maintenance of intestinal stem cells and Paneth cell differentiation in postnatal intestinal crypts, Acts as a regulator of bone formation and remodeling, Involved in kidney development; required for maintaining the ureteric bud in an undifferentiated state, Involved in the development of the anterior segment of the eye, Required during erythropoiesis, Also acts as a negative regulator of innate immunity by inhibiting TLR2/TLR4 associated pattern-recognition and pro-inflammatory cytokine production, Plays an important role in regulating the circadian rhythms of plasma lipids, partially through regulating the rhythmic expression of MTTP (PubMed:24353284), Required for proper development of GnRH neurons (gonadotropin-releasing hormone expressing neurons) that control the release of reproductive hormones from the pituitary gland (PubMed:32493844)",
"SUBCELLULAR LOCATION": "Cell membrane",
"SIMILARITY": "Belongs to the G-protein coupled receptor 1 family",
"domain_description": {
"C2H2-type Zinc finger": null,
"C2H2-type; degenerate Zinc finger": null,
"Ig-like V-type Immunoglobulin domain": null,
"RING-type; degenerate Zinc finger": null,
"BED-type Zinc finger": null,
"Ig-like C2-type Immunoglobulin domain": null,
"C5HC2 Zinc finger": null,
"C2H2-type 2; degenerate Zinc finger": null,
"C2H2-type 5; degenerate Zinc finger": null,
"DBF4-type Zinc finger": null,
"RING-CH-type Zinc finger": null,
"NR C4-type Zinc finger": null,
"SP-RING-type Zinc finger": null,
"RING-type Zinc finger": null,
"UBZ4-type Zinc finger": null,
"Ig-like C1-type Immunoglobulin domain": null,
"C2HC MYST-type Zinc finger": null,
"RanBP2-type Zinc finger": null,
"Ig-like Immunoglobulin domain": null,
"C3H1-type Zinc finger": null,
"C4-type Zinc finger": null,
"CCHC-type Zinc finger": null,
"RING-type; atypical Zinc finger": null,
"TFIIS-type Zinc finger": null,
"C2H2-type 2; atypical Zinc finger": null,
"RRN7-type Zinc finger": null,
"C2H2-type 1; degenerate Zinc finger": null,
"GATA-type Zinc finger": null,
" Zinc finger": null,
"Phorbol-ester/DAG-type Zinc finger": null,
"CR-type Zinc finger": null,
"GATA-type; atypical Zinc finger": null,
"PHD-type; atypical Zinc finger": null,
"C2H2-type 4; atypical Zinc finger": null,
"B box-type; degenerate Zinc finger": null,
"CCHHC-type Zinc finger": null,
"C2H2-type; atypical Zinc finger": null,
"PHD-type Zinc finger": null,
"SGF11-type Zinc finger": null,
"HIT-type Zinc finger": null,
"C2H2-type 4; degenerate Zinc finger": null,
"FYVE-type; atypical Zinc finger": null,
"FCS-type Zinc finger": null,
"RING-Gid-type Zinc finger": null,
"B box-type 1; atypical Zinc finger": null,
"B box-type Zinc finger": null,
"DNL-type Zinc finger": null,
"CCHH-type Zinc finger": null,
"ZZ-type; degenerate Zinc finger": null,
"C2H2-type 11; degenerate Zinc finger": null,
"UBZ3-type Zinc finger": null,
"PHD-type 2; atypical Zinc finger": null,
"Matrin-type Zinc finger": null,
"MYND-type Zinc finger": null,
"B box-type 2; atypical Zinc finger": null,
"C2H2-type 1; atypical Zinc finger": null,
"TAZ-type Zinc finger": null,
"CHHC U11-48K-type Zinc finger": null,
"UBZ2-type Zinc finger": null,
"C2HC pre-PHD-type Zinc finger": null,
"PHD-type; degenerate Zinc finger": null,
"C2H2-type 3; atypical Zinc finger": null,
"FYVE-type 1; atypical Zinc finger": null,
"FYVE-type Zinc finger": null,
"PARP-type Zinc finger": null,
"Btk-type Zinc finger": null,
"CCHC-type 2; atypical Zinc finger": null,
"ZZ-type Zinc finger": null,
"PHD-type 2; degenerate Zinc finger": null,
"UBP-type; degenerate Zinc finger": null,
"THAP-type Zinc finger": null,
"3CxxC-type Zinc finger": null,
"C2H2-type 6; degenerate Zinc finger": null,
"C2H2-type 7; degenerate Zinc finger": null,
"C2H2-type 9; degenerate Zinc finger": null,
"C2H2-type 6; atypical Zinc finger": null,
"RTR1-type Zinc finger": null,
"CW-type Zinc finger": null,
"FLYWCH-type Zinc finger": null,
"C2H2-type 3; degenerate Zinc finger": null,
"C3HC-type Zinc finger": null,
"CCHHC-type; degenerate Zinc finger": null,
"UBP-type Zinc finger": null,
"UBZ1-type Zinc finger": null,
"B box-type; atypical Zinc finger": null,
"FPG-type Zinc finger": null,
"Dof-type Zinc finger": null,
"ZF-HD dimerization-type; degenerate Zinc finger": null,
"NF-X1-type Zinc finger": null,
"SWIM-type Zinc finger": null,
"C2H2-type 10; degenerate Zinc finger": null,
"C2H2-type 14; degenerate Zinc finger": null,
"CXXC-type Zinc finger": null,
"TFIIB-type Zinc finger": null,
"NOB1 Zinc finger": null,
"C2H2 AKAP95-type Zinc finger": null,
"A20-type Zinc finger": null,
"AN1-type Zinc finger": null,
"MYND-type; atypical Zinc finger": null,
"RING-type 1; atypical Zinc finger": null,
"RING-type 2; atypical Zinc finger": null,
"SIAH-type Zinc finger": null,
"MYND-type; degenerate Zinc finger": null,
"C2H2-type 11; atypical Zinc finger": null
},
"bin_loc": "M",
"split": "train"
} | {
"value": "MPGPLRLLCFFALGLLGSAGPSGAAPPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQALDISMNNITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNILTEVPVRPLSNLPTLQALTLALNNISSIPDFAFTNLSSLVVLHLHNNKIKSLSQHCFDGLDNLETLDLNYNNLDEFPQAIKALPSLKELGFHSNSISVIPDGAFAGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHSLVIRGASLVQWFPNLAGTVHLESLTLTGTKISSIPDDLCQNQKMLRTLDLSYNDIRDLPSFNGCRALEEISLQRNQISLIKETTFQGLTSLRILDLSRNLIREIHSGAFAKLGTITNLDVSFNELTSFPTEGLNGLNQLKLVGNFQLKDALAARDFANLRSLSVPYAYQCCAFWGCDSYANLNTEDNSPQDHSVTKEKGATDAANATSTAESEEHSQIIIHCTPSTGAFKPCEYLLGSWMIRLTVWFIFLVALLFNLLVILTVFASCSSLPASKLFIGLISVSNLLMGIYTGILTFLDAVSWGRFAEFGIWWETGSGCKVAGSLAVFSSESAVFLLTLAAVERSVFAKDVMKNGKSSHLRQFQVAALVALLGAAIAGCFPLFHGGQYSASPLCLPFPTGETPSLGFTVTLVLLNSLAFLLMAIIYTKLYCNLEKEDPSENSQSSMIKHVAWLIFTNCIFFCPVAFFSFAPLITAISISPEIMKSVTLIFFPLPACLNPVLYVFFNPKFKDDWKLLKRRVTRKHGSVSVSISSQGGCGEQDFYYDCGMYSHLQGNLTVCDCCESFLLTKPVSCKHLIKSHSCPVLTVASCQRPEAYWSDCGTQSAHSDYADEEDSFVSDSSDQVQACGRACFYQSRGFPLVRYAYNLPRVRD",
"length": 951,
"molWeight": 104150,
"crc64": "AD41C68730A19C6B",
"md5": "F448E498E01432A07FB6AB800B83F8A3"
} |
A2AU37 | This is Double-strand-break repair protein rad21-like protein 1 protein, from Mouse, contains 552 amino acids, locates in Nucleus. | [] | {
"primaryAccession": "A2AU37",
"organism_name": "Mouse",
"protein_name": "Double-strand-break repair protein rad21-like protein 1",
"length": 552,
"firstPublicDate": "2008-02-26T00:00:00",
"FUNCTION": "Meiosis-specific component of some cohesin complex required during the initial steps of prophase I in male meiosis, Probably required during early meiosis in males for separation of sister chromatids and homologous chromosomes, Replaces RAD21 in premeiotic S phase (during early stages of prophase I), while RAD21 reappears in later stages of prophase I, Involved in synaptonemal complex assembly, synapsis initiation and crossover recombination between homologous chromosomes during prophase I, Not required for meiosis in females in young mice, while it is required later as mice age",
"SUBCELLULAR LOCATION": "Nucleus",
"SIMILARITY": "Belongs to the rad21 family",
"domain_description": {
"C2H2-type Zinc finger": null,
"C2H2-type; degenerate Zinc finger": null,
"Ig-like V-type Immunoglobulin domain": null,
"RING-type; degenerate Zinc finger": null,
"BED-type Zinc finger": null,
"Ig-like C2-type Immunoglobulin domain": null,
"C5HC2 Zinc finger": null,
"C2H2-type 2; degenerate Zinc finger": null,
"C2H2-type 5; degenerate Zinc finger": null,
"DBF4-type Zinc finger": null,
"RING-CH-type Zinc finger": null,
"NR C4-type Zinc finger": null,
"SP-RING-type Zinc finger": null,
"RING-type Zinc finger": null,
"UBZ4-type Zinc finger": null,
"Ig-like C1-type Immunoglobulin domain": null,
"C2HC MYST-type Zinc finger": null,
"RanBP2-type Zinc finger": null,
"Ig-like Immunoglobulin domain": null,
"C3H1-type Zinc finger": null,
"C4-type Zinc finger": null,
"CCHC-type Zinc finger": null,
"RING-type; atypical Zinc finger": null,
"TFIIS-type Zinc finger": null,
"C2H2-type 2; atypical Zinc finger": null,
"RRN7-type Zinc finger": null,
"C2H2-type 1; degenerate Zinc finger": null,
"GATA-type Zinc finger": null,
" Zinc finger": null,
"Phorbol-ester/DAG-type Zinc finger": null,
"CR-type Zinc finger": null,
"GATA-type; atypical Zinc finger": null,
"PHD-type; atypical Zinc finger": null,
"C2H2-type 4; atypical Zinc finger": null,
"B box-type; degenerate Zinc finger": null,
"CCHHC-type Zinc finger": null,
"C2H2-type; atypical Zinc finger": null,
"PHD-type Zinc finger": null,
"SGF11-type Zinc finger": null,
"HIT-type Zinc finger": null,
"C2H2-type 4; degenerate Zinc finger": null,
"FYVE-type; atypical Zinc finger": null,
"FCS-type Zinc finger": null,
"RING-Gid-type Zinc finger": null,
"B box-type 1; atypical Zinc finger": null,
"B box-type Zinc finger": null,
"DNL-type Zinc finger": null,
"CCHH-type Zinc finger": null,
"ZZ-type; degenerate Zinc finger": null,
"C2H2-type 11; degenerate Zinc finger": null,
"UBZ3-type Zinc finger": null,
"PHD-type 2; atypical Zinc finger": null,
"Matrin-type Zinc finger": null,
"MYND-type Zinc finger": null,
"B box-type 2; atypical Zinc finger": null,
"C2H2-type 1; atypical Zinc finger": null,
"TAZ-type Zinc finger": null,
"CHHC U11-48K-type Zinc finger": null,
"UBZ2-type Zinc finger": null,
"C2HC pre-PHD-type Zinc finger": null,
"PHD-type; degenerate Zinc finger": null,
"C2H2-type 3; atypical Zinc finger": null,
"FYVE-type 1; atypical Zinc finger": null,
"FYVE-type Zinc finger": null,
"PARP-type Zinc finger": null,
"Btk-type Zinc finger": null,
"CCHC-type 2; atypical Zinc finger": null,
"ZZ-type Zinc finger": null,
"PHD-type 2; degenerate Zinc finger": null,
"UBP-type; degenerate Zinc finger": null,
"THAP-type Zinc finger": null,
"3CxxC-type Zinc finger": null,
"C2H2-type 6; degenerate Zinc finger": null,
"C2H2-type 7; degenerate Zinc finger": null,
"C2H2-type 9; degenerate Zinc finger": null,
"C2H2-type 6; atypical Zinc finger": null,
"RTR1-type Zinc finger": null,
"CW-type Zinc finger": null,
"FLYWCH-type Zinc finger": null,
"C2H2-type 3; degenerate Zinc finger": null,
"C3HC-type Zinc finger": null,
"CCHHC-type; degenerate Zinc finger": null,
"UBP-type Zinc finger": null,
"UBZ1-type Zinc finger": null,
"B box-type; atypical Zinc finger": null,
"FPG-type Zinc finger": null,
"Dof-type Zinc finger": null,
"ZF-HD dimerization-type; degenerate Zinc finger": null,
"NF-X1-type Zinc finger": null,
"SWIM-type Zinc finger": null,
"C2H2-type 10; degenerate Zinc finger": null,
"C2H2-type 14; degenerate Zinc finger": null,
"CXXC-type Zinc finger": null,
"TFIIB-type Zinc finger": null,
"NOB1 Zinc finger": null,
"C2H2 AKAP95-type Zinc finger": null,
"A20-type Zinc finger": null,
"AN1-type Zinc finger": null,
"MYND-type; atypical Zinc finger": null,
"RING-type 1; atypical Zinc finger": null,
"RING-type 2; atypical Zinc finger": null,
"SIAH-type Zinc finger": null,
"MYND-type; degenerate Zinc finger": null,
"C2H2-type 11; atypical Zinc finger": null
},
"bin_loc": "U",
"split": "train"
} | {
"value": "MFYTHVLMSKRGPLAKIWLAAHWEKKLTKAHVFECNLEITIQKIISPKVKIALRTSGHLLLGVVRIYNRKAKYLLADCSEAFLKMKMTFRPGLVDLPKENFEAAYNTITLPEEFHDFEIYNINEIDISEPLAQNQSRPEEITLREEYSNDLLFQAGSFGDEPEILRRHSFFDDNILMNSSGLVVEHSSGSFAEEKSLFFDNGDGFGDEGAAGEMIDNLLQDESTFLEEAYLNKEVSLPPELPSSIMVEPGNSDDQCIPEDEEINEITLLSNEDEGFTLDPIDDLDIADRRRRKKRRLLVDPVKEISSKAMHRQLASFMDTLMVLDLAPPTQRLMMWKKRGGVDMLLSTATQDLINDELKMLFTKCFLSSDYKLAKLTLKESVRKEVGNQQIAEPSVMGEPNSHSELDQPQDWKDVTDESVGSFQENVNMNVNSEQDILGMISPAVEGLSSMNGSLAQENCPAELESSGSKQNTEAEKWNQRLFQTLNVLREFNKMGMQSFSLKKLCRNSDRKQAAAKFYTLLILKKHRAIELSQSVPYADIIATVGPMFYKM",
"length": 552,
"molWeight": 62670,
"crc64": "3953B40BFE0749B9",
"md5": "ED5D7DA65F3B4C16255403E950E2A97E"
} |
A2RVM0 | This is Short-chain dehydrogenase TIC 32, chloroplastic protein, from Mouse-ear cress, contains 322 amino acids, is membrane-bound, locates in Plastid. | [] | {
"primaryAccession": "A2RVM0",
"organism_name": "Mouse-ear cress",
"protein_name": "Short-chain dehydrogenase TIC 32, chloroplastic",
"length": 322,
"firstPublicDate": "2011-10-19T00:00:00",
"FUNCTION": "Involved in protein precursor import into chloroplasts, Part of the redox regulon consisting of TIC32, TIC 55 and TIC62",
"SUBCELLULAR LOCATION": "Plastid",
"SIMILARITY": "Belongs to the short-chain dehydrogenases/reductases (SDR) family",
"domain_description": {
"C2H2-type Zinc finger": null,
"C2H2-type; degenerate Zinc finger": null,
"Ig-like V-type Immunoglobulin domain": null,
"RING-type; degenerate Zinc finger": null,
"BED-type Zinc finger": null,
"Ig-like C2-type Immunoglobulin domain": null,
"C5HC2 Zinc finger": null,
"C2H2-type 2; degenerate Zinc finger": null,
"C2H2-type 5; degenerate Zinc finger": null,
"DBF4-type Zinc finger": null,
"RING-CH-type Zinc finger": null,
"NR C4-type Zinc finger": null,
"SP-RING-type Zinc finger": null,
"RING-type Zinc finger": null,
"UBZ4-type Zinc finger": null,
"Ig-like C1-type Immunoglobulin domain": null,
"C2HC MYST-type Zinc finger": null,
"RanBP2-type Zinc finger": null,
"Ig-like Immunoglobulin domain": null,
"C3H1-type Zinc finger": null,
"C4-type Zinc finger": null,
"CCHC-type Zinc finger": null,
"RING-type; atypical Zinc finger": null,
"TFIIS-type Zinc finger": null,
"C2H2-type 2; atypical Zinc finger": null,
"RRN7-type Zinc finger": null,
"C2H2-type 1; degenerate Zinc finger": null,
"GATA-type Zinc finger": null,
" Zinc finger": null,
"Phorbol-ester/DAG-type Zinc finger": null,
"CR-type Zinc finger": null,
"GATA-type; atypical Zinc finger": null,
"PHD-type; atypical Zinc finger": null,
"C2H2-type 4; atypical Zinc finger": null,
"B box-type; degenerate Zinc finger": null,
"CCHHC-type Zinc finger": null,
"C2H2-type; atypical Zinc finger": null,
"PHD-type Zinc finger": null,
"SGF11-type Zinc finger": null,
"HIT-type Zinc finger": null,
"C2H2-type 4; degenerate Zinc finger": null,
"FYVE-type; atypical Zinc finger": null,
"FCS-type Zinc finger": null,
"RING-Gid-type Zinc finger": null,
"B box-type 1; atypical Zinc finger": null,
"B box-type Zinc finger": null,
"DNL-type Zinc finger": null,
"CCHH-type Zinc finger": null,
"ZZ-type; degenerate Zinc finger": null,
"C2H2-type 11; degenerate Zinc finger": null,
"UBZ3-type Zinc finger": null,
"PHD-type 2; atypical Zinc finger": null,
"Matrin-type Zinc finger": null,
"MYND-type Zinc finger": null,
"B box-type 2; atypical Zinc finger": null,
"C2H2-type 1; atypical Zinc finger": null,
"TAZ-type Zinc finger": null,
"CHHC U11-48K-type Zinc finger": null,
"UBZ2-type Zinc finger": null,
"C2HC pre-PHD-type Zinc finger": null,
"PHD-type; degenerate Zinc finger": null,
"C2H2-type 3; atypical Zinc finger": null,
"FYVE-type 1; atypical Zinc finger": null,
"FYVE-type Zinc finger": null,
"PARP-type Zinc finger": null,
"Btk-type Zinc finger": null,
"CCHC-type 2; atypical Zinc finger": null,
"ZZ-type Zinc finger": null,
"PHD-type 2; degenerate Zinc finger": null,
"UBP-type; degenerate Zinc finger": null,
"THAP-type Zinc finger": null,
"3CxxC-type Zinc finger": null,
"C2H2-type 6; degenerate Zinc finger": null,
"C2H2-type 7; degenerate Zinc finger": null,
"C2H2-type 9; degenerate Zinc finger": null,
"C2H2-type 6; atypical Zinc finger": null,
"RTR1-type Zinc finger": null,
"CW-type Zinc finger": null,
"FLYWCH-type Zinc finger": null,
"C2H2-type 3; degenerate Zinc finger": null,
"C3HC-type Zinc finger": null,
"CCHHC-type; degenerate Zinc finger": null,
"UBP-type Zinc finger": null,
"UBZ1-type Zinc finger": null,
"B box-type; atypical Zinc finger": null,
"FPG-type Zinc finger": null,
"Dof-type Zinc finger": null,
"ZF-HD dimerization-type; degenerate Zinc finger": null,
"NF-X1-type Zinc finger": null,
"SWIM-type Zinc finger": null,
"C2H2-type 10; degenerate Zinc finger": null,
"C2H2-type 14; degenerate Zinc finger": null,
"CXXC-type Zinc finger": null,
"TFIIB-type Zinc finger": null,
"NOB1 Zinc finger": null,
"C2H2 AKAP95-type Zinc finger": null,
"A20-type Zinc finger": null,
"AN1-type Zinc finger": null,
"MYND-type; atypical Zinc finger": null,
"RING-type 1; atypical Zinc finger": null,
"RING-type 2; atypical Zinc finger": null,
"SIAH-type Zinc finger": null,
"MYND-type; degenerate Zinc finger": null,
"C2H2-type 11; atypical Zinc finger": null
},
"bin_loc": "M",
"split": "train"
} | {
"value": "MWFFGSKGASGFSSRSTAEEVTHGVDGTGLTAIVTGASSGIGVETARVLSLRGVHVVMAVRNTDSGAKVKEDIVKQVPGAKLDVMELDLSSMQSVRKFASEYKSTGLPLNLLINNAGIMACPFMLSKDNIELQFATNHLGHFLLTKLLLDTMKSTSRESKREGRIVNLSSEAHRFSYPEGVRFDKINDKSSYSSMRAYGQSKLCNVLHANELTKQLKEDGVNITANSLHPGAIMTNLGRYFNPYLAVAVGAVAKYILKSVPQGAATTCYVALNPQVAGVSGEYFQDSNIAKPLPLVKDTELAKKVWDFSTKLTDSQSGESSS",
"length": 322,
"molWeight": 34740,
"crc64": "22B3DF0CA39B8A10",
"md5": "85D1EA8C7499782DD8F5BC7EED581CA4"
} |
A2VBC4 | This is Phospholipase A1 protein, from Neotropical social wasp, contains 322 amino acids, is soluble, locates in Extracellular. | [] | {
"primaryAccession": "A2VBC4",
"organism_name": "Neotropical social wasp",
"protein_name": "Phospholipase A1",
"length": 322,
"firstPublicDate": "2008-01-15T00:00:00",
"FUNCTION": "Catalyzes the hydrolysis of phosphatidylcholine with phospholipase A1 activity (PubMed:17761205), Shows hemolytic activity (PubMed:17761205), Acts as an allergen (PubMed:17761205)",
"SUBCELLULAR LOCATION": "Extracellular",
"SIMILARITY": "Belongs to the AB hydrolase superfamily, Lipase family",
"domain_description": {
"C2H2-type Zinc finger": null,
"C2H2-type; degenerate Zinc finger": null,
"Ig-like V-type Immunoglobulin domain": null,
"RING-type; degenerate Zinc finger": null,
"BED-type Zinc finger": null,
"Ig-like C2-type Immunoglobulin domain": null,
"C5HC2 Zinc finger": null,
"C2H2-type 2; degenerate Zinc finger": null,
"C2H2-type 5; degenerate Zinc finger": null,
"DBF4-type Zinc finger": null,
"RING-CH-type Zinc finger": null,
"NR C4-type Zinc finger": null,
"SP-RING-type Zinc finger": null,
"RING-type Zinc finger": null,
"UBZ4-type Zinc finger": null,
"Ig-like C1-type Immunoglobulin domain": null,
"C2HC MYST-type Zinc finger": null,
"RanBP2-type Zinc finger": null,
"Ig-like Immunoglobulin domain": null,
"C3H1-type Zinc finger": null,
"C4-type Zinc finger": null,
"CCHC-type Zinc finger": null,
"RING-type; atypical Zinc finger": null,
"TFIIS-type Zinc finger": null,
"C2H2-type 2; atypical Zinc finger": null,
"RRN7-type Zinc finger": null,
"C2H2-type 1; degenerate Zinc finger": null,
"GATA-type Zinc finger": null,
" Zinc finger": null,
"Phorbol-ester/DAG-type Zinc finger": null,
"CR-type Zinc finger": null,
"GATA-type; atypical Zinc finger": null,
"PHD-type; atypical Zinc finger": null,
"C2H2-type 4; atypical Zinc finger": null,
"B box-type; degenerate Zinc finger": null,
"CCHHC-type Zinc finger": null,
"C2H2-type; atypical Zinc finger": null,
"PHD-type Zinc finger": null,
"SGF11-type Zinc finger": null,
"HIT-type Zinc finger": null,
"C2H2-type 4; degenerate Zinc finger": null,
"FYVE-type; atypical Zinc finger": null,
"FCS-type Zinc finger": null,
"RING-Gid-type Zinc finger": null,
"B box-type 1; atypical Zinc finger": null,
"B box-type Zinc finger": null,
"DNL-type Zinc finger": null,
"CCHH-type Zinc finger": null,
"ZZ-type; degenerate Zinc finger": null,
"C2H2-type 11; degenerate Zinc finger": null,
"UBZ3-type Zinc finger": null,
"PHD-type 2; atypical Zinc finger": null,
"Matrin-type Zinc finger": null,
"MYND-type Zinc finger": null,
"B box-type 2; atypical Zinc finger": null,
"C2H2-type 1; atypical Zinc finger": null,
"TAZ-type Zinc finger": null,
"CHHC U11-48K-type Zinc finger": null,
"UBZ2-type Zinc finger": null,
"C2HC pre-PHD-type Zinc finger": null,
"PHD-type; degenerate Zinc finger": null,
"C2H2-type 3; atypical Zinc finger": null,
"FYVE-type 1; atypical Zinc finger": null,
"FYVE-type Zinc finger": null,
"PARP-type Zinc finger": null,
"Btk-type Zinc finger": null,
"CCHC-type 2; atypical Zinc finger": null,
"ZZ-type Zinc finger": null,
"PHD-type 2; degenerate Zinc finger": null,
"UBP-type; degenerate Zinc finger": null,
"THAP-type Zinc finger": null,
"3CxxC-type Zinc finger": null,
"C2H2-type 6; degenerate Zinc finger": null,
"C2H2-type 7; degenerate Zinc finger": null,
"C2H2-type 9; degenerate Zinc finger": null,
"C2H2-type 6; atypical Zinc finger": null,
"RTR1-type Zinc finger": null,
"CW-type Zinc finger": null,
"FLYWCH-type Zinc finger": null,
"C2H2-type 3; degenerate Zinc finger": null,
"C3HC-type Zinc finger": null,
"CCHHC-type; degenerate Zinc finger": null,
"UBP-type Zinc finger": null,
"UBZ1-type Zinc finger": null,
"B box-type; atypical Zinc finger": null,
"FPG-type Zinc finger": null,
"Dof-type Zinc finger": null,
"ZF-HD dimerization-type; degenerate Zinc finger": null,
"NF-X1-type Zinc finger": null,
"SWIM-type Zinc finger": null,
"C2H2-type 10; degenerate Zinc finger": null,
"C2H2-type 14; degenerate Zinc finger": null,
"CXXC-type Zinc finger": null,
"TFIIB-type Zinc finger": null,
"NOB1 Zinc finger": null,
"C2H2 AKAP95-type Zinc finger": null,
"A20-type Zinc finger": null,
"AN1-type Zinc finger": null,
"MYND-type; atypical Zinc finger": null,
"RING-type 1; atypical Zinc finger": null,
"RING-type 2; atypical Zinc finger": null,
"SIAH-type Zinc finger": null,
"MYND-type; degenerate Zinc finger": null,
"C2H2-type 11; atypical Zinc finger": null
},
"bin_loc": "S",
"split": "train"
} | {
"value": "MNFKYSILFICFGTLDRGLIPECPFNEYDILFFVYTRQQRDGIVLTEETLQNYDLFKKSTISRQVVFIDHGFLSNGNNENFIAMAKALIEKDNFLVISVDWKKGACNAFASTLDYLGYSTAVGNTRHVGKYVADFTKLLVEQYKVSMSNIRLIGHSLGAHTSGFAGKEVQELKLNKYSNIDGLDPAGPSFDSNDCPERLCETDAEYVQIIHTSNILGVYSKIGTVDFYMNYGSHQPGCGRFFSPSCSHTKAVKYLTECIKHECCLIGTPWKKYFSTPKPISQCTKDTCVCVGLNAKSYPARGSFYVPVEATAPYCHNEGIKL",
"length": 322,
"molWeight": 36082,
"crc64": "64A39D6D33AD86A8",
"md5": "E1593652260505B9E151A1ECEF87F2FF"
} |
A2VCW5 | This is Sodium-coupled neutral amino acid transporter 5 protein, from Rat, contains 479 amino acids, is membrane-bound, locates in Cell membrane. | [] | {
"primaryAccession": "A2VCW5",
"organism_name": "Rat",
"protein_name": "Sodium-coupled neutral amino acid transporter 5",
"length": 479,
"firstPublicDate": "2007-12-04T00:00:00",
"FUNCTION": "Symporter that cotransports neutral amino acids and sodium ions, coupled to an H(+) antiporter activity (PubMed:11698233, PubMed:16629640, PubMed:15218073, PubMed:22821889, PubMed:16249471), Releases L-glutamine and glycine from astroglial cells and may participate in the glutamate/GABA-glutamine cycle and the NMDA receptors activation (PubMed:22821889), In addition contributes significantly to L-glutamine uptake in retina, namely in ganglion and Mueller cells and, therefore participates in the retinal glutamate-glutamine cycle (PubMed:16249471), The transport activity is pH sensitive (PubMed:22821889, PubMed:15218073, PubMed:11698233), Li(+) tolerant (PubMed:22821889, PubMed:15218073, PubMed:11698233), bidirectional (PubMed:22821889, PubMed:15218073) and associated with large uncoupled fluxes of protons (PubMed:22821889, PubMed:15218073, PubMed:11698233), The transport is electroneutral coupled to the cotransport of 1 Na(+) and the antiport of 1 H(+) (PubMed:22821889), May have particular importance for modulation of net hepatic glutamine flux (PubMed:15218073)",
"SUBCELLULAR LOCATION": "Cell membrane",
"SIMILARITY": "Belongs to the amino acid/polyamine transporter 2 family",
"domain_description": {
"C2H2-type Zinc finger": null,
"C2H2-type; degenerate Zinc finger": null,
"Ig-like V-type Immunoglobulin domain": null,
"RING-type; degenerate Zinc finger": null,
"BED-type Zinc finger": null,
"Ig-like C2-type Immunoglobulin domain": null,
"C5HC2 Zinc finger": null,
"C2H2-type 2; degenerate Zinc finger": null,
"C2H2-type 5; degenerate Zinc finger": null,
"DBF4-type Zinc finger": null,
"RING-CH-type Zinc finger": null,
"NR C4-type Zinc finger": null,
"SP-RING-type Zinc finger": null,
"RING-type Zinc finger": null,
"UBZ4-type Zinc finger": null,
"Ig-like C1-type Immunoglobulin domain": null,
"C2HC MYST-type Zinc finger": null,
"RanBP2-type Zinc finger": null,
"Ig-like Immunoglobulin domain": null,
"C3H1-type Zinc finger": null,
"C4-type Zinc finger": null,
"CCHC-type Zinc finger": null,
"RING-type; atypical Zinc finger": null,
"TFIIS-type Zinc finger": null,
"C2H2-type 2; atypical Zinc finger": null,
"RRN7-type Zinc finger": null,
"C2H2-type 1; degenerate Zinc finger": null,
"GATA-type Zinc finger": null,
" Zinc finger": null,
"Phorbol-ester/DAG-type Zinc finger": null,
"CR-type Zinc finger": null,
"GATA-type; atypical Zinc finger": null,
"PHD-type; atypical Zinc finger": null,
"C2H2-type 4; atypical Zinc finger": null,
"B box-type; degenerate Zinc finger": null,
"CCHHC-type Zinc finger": null,
"C2H2-type; atypical Zinc finger": null,
"PHD-type Zinc finger": null,
"SGF11-type Zinc finger": null,
"HIT-type Zinc finger": null,
"C2H2-type 4; degenerate Zinc finger": null,
"FYVE-type; atypical Zinc finger": null,
"FCS-type Zinc finger": null,
"RING-Gid-type Zinc finger": null,
"B box-type 1; atypical Zinc finger": null,
"B box-type Zinc finger": null,
"DNL-type Zinc finger": null,
"CCHH-type Zinc finger": null,
"ZZ-type; degenerate Zinc finger": null,
"C2H2-type 11; degenerate Zinc finger": null,
"UBZ3-type Zinc finger": null,
"PHD-type 2; atypical Zinc finger": null,
"Matrin-type Zinc finger": null,
"MYND-type Zinc finger": null,
"B box-type 2; atypical Zinc finger": null,
"C2H2-type 1; atypical Zinc finger": null,
"TAZ-type Zinc finger": null,
"CHHC U11-48K-type Zinc finger": null,
"UBZ2-type Zinc finger": null,
"C2HC pre-PHD-type Zinc finger": null,
"PHD-type; degenerate Zinc finger": null,
"C2H2-type 3; atypical Zinc finger": null,
"FYVE-type 1; atypical Zinc finger": null,
"FYVE-type Zinc finger": null,
"PARP-type Zinc finger": null,
"Btk-type Zinc finger": null,
"CCHC-type 2; atypical Zinc finger": null,
"ZZ-type Zinc finger": null,
"PHD-type 2; degenerate Zinc finger": null,
"UBP-type; degenerate Zinc finger": null,
"THAP-type Zinc finger": null,
"3CxxC-type Zinc finger": null,
"C2H2-type 6; degenerate Zinc finger": null,
"C2H2-type 7; degenerate Zinc finger": null,
"C2H2-type 9; degenerate Zinc finger": null,
"C2H2-type 6; atypical Zinc finger": null,
"RTR1-type Zinc finger": null,
"CW-type Zinc finger": null,
"FLYWCH-type Zinc finger": null,
"C2H2-type 3; degenerate Zinc finger": null,
"C3HC-type Zinc finger": null,
"CCHHC-type; degenerate Zinc finger": null,
"UBP-type Zinc finger": null,
"UBZ1-type Zinc finger": null,
"B box-type; atypical Zinc finger": null,
"FPG-type Zinc finger": null,
"Dof-type Zinc finger": null,
"ZF-HD dimerization-type; degenerate Zinc finger": null,
"NF-X1-type Zinc finger": null,
"SWIM-type Zinc finger": null,
"C2H2-type 10; degenerate Zinc finger": null,
"C2H2-type 14; degenerate Zinc finger": null,
"CXXC-type Zinc finger": null,
"TFIIB-type Zinc finger": null,
"NOB1 Zinc finger": null,
"C2H2 AKAP95-type Zinc finger": null,
"A20-type Zinc finger": null,
"AN1-type Zinc finger": null,
"MYND-type; atypical Zinc finger": null,
"RING-type 1; atypical Zinc finger": null,
"RING-type 2; atypical Zinc finger": null,
"SIAH-type Zinc finger": null,
"MYND-type; degenerate Zinc finger": null,
"C2H2-type 11; atypical Zinc finger": null
},
"bin_loc": "M",
"split": "train"
} | {
"value": "MAISCAVGMEMQEPKMNGTLSTGAAAGYRQEREGFLPTTHGPAPGRKPVQFLDFEGKTSFGMSVFNLSNAIMGSGILGLAYAMAHTGVIFFLALLLCIALLSSYSIHLLLTCASVVGIRAYEQLGQRAFGPAGKVVVAIIICLHNVGAMSSYLFIIKSELPLVIGTFLHMDPEGDWFLKGNLLIILVSLLIILPLALMKHLGYLGYTSSLSLTCMLFFLISVIYKKFQLGCVVSHNDTVVESEPAPLQAFNSSCEAKLFTVDSQMSYTVPIMAFAFVCHPEVLPIYTELCCPTQRRMQAVANMSIGAMFIMYGLTATFGYLTFYSTVKAEMLEMYTQEDLLILCVRLAVLLAVTLTVPVVLFPIRRALQQLLFPSKAFSWPRHVAIALILLILVNILVICVPTIRDIFGFIGSTSAPSLIFILPSVFYLRIVPADMEPLFSWPKIQALCFGVLGVLFMAISLGFMFANWATGQSRMSGH",
"length": 479,
"molWeight": 52436,
"crc64": "DC172C28CB7F5EDC",
"md5": "7631C3AF0F1C2CE942A3FEA251CB4075"
} |
A4D1E9 | This is GTP-binding protein 10 protein, from Human, contains 387 amino acids, locates in Nucleus. | [] | {
"primaryAccession": "A4D1E9",
"organism_name": "Human",
"protein_name": "GTP-binding protein 10",
"length": 387,
"firstPublicDate": "2007-12-04T00:00:00",
"FUNCTION": "May be involved in the ribosome maturation process, Complements an ObgE(CgtA) function in E,coli ribosome maturation, Plays a role of GTPase in vitro, When missing, disorganization of the nucleolar architecture is observed",
"SUBCELLULAR LOCATION": "Nucleus",
"SIMILARITY": "Belongs to the TRAFAC class OBG-HflX-like GTPase superfamily, OBG GTPase family",
"domain_description": {
"C2H2-type Zinc finger": null,
"C2H2-type; degenerate Zinc finger": null,
"Ig-like V-type Immunoglobulin domain": null,
"RING-type; degenerate Zinc finger": null,
"BED-type Zinc finger": null,
"Ig-like C2-type Immunoglobulin domain": null,
"C5HC2 Zinc finger": null,
"C2H2-type 2; degenerate Zinc finger": null,
"C2H2-type 5; degenerate Zinc finger": null,
"DBF4-type Zinc finger": null,
"RING-CH-type Zinc finger": null,
"NR C4-type Zinc finger": null,
"SP-RING-type Zinc finger": null,
"RING-type Zinc finger": null,
"UBZ4-type Zinc finger": null,
"Ig-like C1-type Immunoglobulin domain": null,
"C2HC MYST-type Zinc finger": null,
"RanBP2-type Zinc finger": null,
"Ig-like Immunoglobulin domain": null,
"C3H1-type Zinc finger": null,
"C4-type Zinc finger": null,
"CCHC-type Zinc finger": null,
"RING-type; atypical Zinc finger": null,
"TFIIS-type Zinc finger": null,
"C2H2-type 2; atypical Zinc finger": null,
"RRN7-type Zinc finger": null,
"C2H2-type 1; degenerate Zinc finger": null,
"GATA-type Zinc finger": null,
" Zinc finger": null,
"Phorbol-ester/DAG-type Zinc finger": null,
"CR-type Zinc finger": null,
"GATA-type; atypical Zinc finger": null,
"PHD-type; atypical Zinc finger": null,
"C2H2-type 4; atypical Zinc finger": null,
"B box-type; degenerate Zinc finger": null,
"CCHHC-type Zinc finger": null,
"C2H2-type; atypical Zinc finger": null,
"PHD-type Zinc finger": null,
"SGF11-type Zinc finger": null,
"HIT-type Zinc finger": null,
"C2H2-type 4; degenerate Zinc finger": null,
"FYVE-type; atypical Zinc finger": null,
"FCS-type Zinc finger": null,
"RING-Gid-type Zinc finger": null,
"B box-type 1; atypical Zinc finger": null,
"B box-type Zinc finger": null,
"DNL-type Zinc finger": null,
"CCHH-type Zinc finger": null,
"ZZ-type; degenerate Zinc finger": null,
"C2H2-type 11; degenerate Zinc finger": null,
"UBZ3-type Zinc finger": null,
"PHD-type 2; atypical Zinc finger": null,
"Matrin-type Zinc finger": null,
"MYND-type Zinc finger": null,
"B box-type 2; atypical Zinc finger": null,
"C2H2-type 1; atypical Zinc finger": null,
"TAZ-type Zinc finger": null,
"CHHC U11-48K-type Zinc finger": null,
"UBZ2-type Zinc finger": null,
"C2HC pre-PHD-type Zinc finger": null,
"PHD-type; degenerate Zinc finger": null,
"C2H2-type 3; atypical Zinc finger": null,
"FYVE-type 1; atypical Zinc finger": null,
"FYVE-type Zinc finger": null,
"PARP-type Zinc finger": null,
"Btk-type Zinc finger": null,
"CCHC-type 2; atypical Zinc finger": null,
"ZZ-type Zinc finger": null,
"PHD-type 2; degenerate Zinc finger": null,
"UBP-type; degenerate Zinc finger": null,
"THAP-type Zinc finger": null,
"3CxxC-type Zinc finger": null,
"C2H2-type 6; degenerate Zinc finger": null,
"C2H2-type 7; degenerate Zinc finger": null,
"C2H2-type 9; degenerate Zinc finger": null,
"C2H2-type 6; atypical Zinc finger": null,
"RTR1-type Zinc finger": null,
"CW-type Zinc finger": null,
"FLYWCH-type Zinc finger": null,
"C2H2-type 3; degenerate Zinc finger": null,
"C3HC-type Zinc finger": null,
"CCHHC-type; degenerate Zinc finger": null,
"UBP-type Zinc finger": null,
"UBZ1-type Zinc finger": null,
"B box-type; atypical Zinc finger": null,
"FPG-type Zinc finger": null,
"Dof-type Zinc finger": null,
"ZF-HD dimerization-type; degenerate Zinc finger": null,
"NF-X1-type Zinc finger": null,
"SWIM-type Zinc finger": null,
"C2H2-type 10; degenerate Zinc finger": null,
"C2H2-type 14; degenerate Zinc finger": null,
"CXXC-type Zinc finger": null,
"TFIIB-type Zinc finger": null,
"NOB1 Zinc finger": null,
"C2H2 AKAP95-type Zinc finger": null,
"A20-type Zinc finger": null,
"AN1-type Zinc finger": null,
"MYND-type; atypical Zinc finger": null,
"RING-type 1; atypical Zinc finger": null,
"RING-type 2; atypical Zinc finger": null,
"SIAH-type Zinc finger": null,
"MYND-type; degenerate Zinc finger": null,
"C2H2-type 11; atypical Zinc finger": null
},
"bin_loc": "U",
"split": "train"
} | {
"value": "MVHCSCVLFRKYGNFIDKLRLFTRGGSGGMGYPRLGGEGGKGGDVWVVAQNRMTLKQLKDRYPRKRFVAGVGANSKISALKGSKGKDCEIPVPVGISVTDENGKIIGELNKENDRILVAQGGLGGKLLTNFLPLKGQKRIIHLDLKLIADVGLVGFPNAGKSSLLSCVSHAKPAIADYAFTTLKPELGKIMYSDFKQISVADLPGLIEGAHMNKGMGHKFLKHIERTRQLLFVVDISGFQLSSHTQYRTAFETIILLTKELELYKEELQTKPALLAVNKMDLPDAQDKFHELMSQLQNPKDFLHLFEKNMIPERTVEFQHIIPISAVTGEGIEELKNCIRKSLDEQANQENDALHKKQLLNLWISDTMSSTEPPSKHAVTTSKMDII",
"length": 387,
"molWeight": 42933,
"crc64": "1A89697B83320075",
"md5": "3828DB598320C2BB005A3AE2A6F89A14"
} |
A4L691 | This is PIN2/TERF1-interacting telomerase inhibitor 1 protein, from Rat, contains 331 amino acids, locates in Nucleus. | [] | {
"primaryAccession": "A4L691",
"organism_name": "Rat",
"protein_name": "PIN2/TERF1-interacting telomerase inhibitor 1",
"length": 331,
"firstPublicDate": "2007-07-10T00:00:00",
"FUNCTION": "Microtubule-binding protein essential for faithful chromosome segregation, Mediates TRF1 and TERT accumulation in nucleolus and enhances TRF1 binding to telomeres, Inhibits telomerase activity, May inhibit cell proliferation and act as tumor suppressor (By similarity)",
"SUBCELLULAR LOCATION": "Nucleus",
"SIMILARITY": "Belongs to the PINX1 family",
"domain_description": {
"C2H2-type Zinc finger": null,
"C2H2-type; degenerate Zinc finger": null,
"Ig-like V-type Immunoglobulin domain": null,
"RING-type; degenerate Zinc finger": null,
"BED-type Zinc finger": null,
"Ig-like C2-type Immunoglobulin domain": null,
"C5HC2 Zinc finger": null,
"C2H2-type 2; degenerate Zinc finger": null,
"C2H2-type 5; degenerate Zinc finger": null,
"DBF4-type Zinc finger": null,
"RING-CH-type Zinc finger": null,
"NR C4-type Zinc finger": null,
"SP-RING-type Zinc finger": null,
"RING-type Zinc finger": null,
"UBZ4-type Zinc finger": null,
"Ig-like C1-type Immunoglobulin domain": null,
"C2HC MYST-type Zinc finger": null,
"RanBP2-type Zinc finger": null,
"Ig-like Immunoglobulin domain": null,
"C3H1-type Zinc finger": null,
"C4-type Zinc finger": null,
"CCHC-type Zinc finger": null,
"RING-type; atypical Zinc finger": null,
"TFIIS-type Zinc finger": null,
"C2H2-type 2; atypical Zinc finger": null,
"RRN7-type Zinc finger": null,
"C2H2-type 1; degenerate Zinc finger": null,
"GATA-type Zinc finger": null,
" Zinc finger": null,
"Phorbol-ester/DAG-type Zinc finger": null,
"CR-type Zinc finger": null,
"GATA-type; atypical Zinc finger": null,
"PHD-type; atypical Zinc finger": null,
"C2H2-type 4; atypical Zinc finger": null,
"B box-type; degenerate Zinc finger": null,
"CCHHC-type Zinc finger": null,
"C2H2-type; atypical Zinc finger": null,
"PHD-type Zinc finger": null,
"SGF11-type Zinc finger": null,
"HIT-type Zinc finger": null,
"C2H2-type 4; degenerate Zinc finger": null,
"FYVE-type; atypical Zinc finger": null,
"FCS-type Zinc finger": null,
"RING-Gid-type Zinc finger": null,
"B box-type 1; atypical Zinc finger": null,
"B box-type Zinc finger": null,
"DNL-type Zinc finger": null,
"CCHH-type Zinc finger": null,
"ZZ-type; degenerate Zinc finger": null,
"C2H2-type 11; degenerate Zinc finger": null,
"UBZ3-type Zinc finger": null,
"PHD-type 2; atypical Zinc finger": null,
"Matrin-type Zinc finger": null,
"MYND-type Zinc finger": null,
"B box-type 2; atypical Zinc finger": null,
"C2H2-type 1; atypical Zinc finger": null,
"TAZ-type Zinc finger": null,
"CHHC U11-48K-type Zinc finger": null,
"UBZ2-type Zinc finger": null,
"C2HC pre-PHD-type Zinc finger": null,
"PHD-type; degenerate Zinc finger": null,
"C2H2-type 3; atypical Zinc finger": null,
"FYVE-type 1; atypical Zinc finger": null,
"FYVE-type Zinc finger": null,
"PARP-type Zinc finger": null,
"Btk-type Zinc finger": null,
"CCHC-type 2; atypical Zinc finger": null,
"ZZ-type Zinc finger": null,
"PHD-type 2; degenerate Zinc finger": null,
"UBP-type; degenerate Zinc finger": null,
"THAP-type Zinc finger": null,
"3CxxC-type Zinc finger": null,
"C2H2-type 6; degenerate Zinc finger": null,
"C2H2-type 7; degenerate Zinc finger": null,
"C2H2-type 9; degenerate Zinc finger": null,
"C2H2-type 6; atypical Zinc finger": null,
"RTR1-type Zinc finger": null,
"CW-type Zinc finger": null,
"FLYWCH-type Zinc finger": null,
"C2H2-type 3; degenerate Zinc finger": null,
"C3HC-type Zinc finger": null,
"CCHHC-type; degenerate Zinc finger": null,
"UBP-type Zinc finger": null,
"UBZ1-type Zinc finger": null,
"B box-type; atypical Zinc finger": null,
"FPG-type Zinc finger": null,
"Dof-type Zinc finger": null,
"ZF-HD dimerization-type; degenerate Zinc finger": null,
"NF-X1-type Zinc finger": null,
"SWIM-type Zinc finger": null,
"C2H2-type 10; degenerate Zinc finger": null,
"C2H2-type 14; degenerate Zinc finger": null,
"CXXC-type Zinc finger": null,
"TFIIB-type Zinc finger": null,
"NOB1 Zinc finger": null,
"C2H2 AKAP95-type Zinc finger": null,
"A20-type Zinc finger": null,
"AN1-type Zinc finger": null,
"MYND-type; atypical Zinc finger": null,
"RING-type 1; atypical Zinc finger": null,
"RING-type 2; atypical Zinc finger": null,
"SIAH-type Zinc finger": null,
"MYND-type; degenerate Zinc finger": null,
"C2H2-type 11; atypical Zinc finger": null
},
"bin_loc": "U",
"split": "train"
} | {
"value": "MSMLAERRRKQKWAVDPRNTAWSNDDSKFGQKMLEKMGWSKGKGLGAQEQGATEHIKVKVKNNHLGLGATNNNEDNWIAHQDDFNQLLAALNTCHGQETADSSDNKEKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSETDLDCIFGKRRNKKLAQDGCSNSTADEADTSLTTTTTTTSAFTIQEYFAKRMAQLKSKSQAAAPGSDLSETPIEWKKGKKKTKEAAGTDIENSPQHKAKRHKKKKRVEAERGPAAKKRDQVELQPGGPSGDECSDASVEAAEDRVQTPDTQDDVPKPRKRRAKKTLQRPGGVAVDTAPDSAPVKKKKKVSR",
"length": 331,
"molWeight": 36710,
"crc64": "B90C47DDB010F254",
"md5": "F76B43EFF7FC00DCB7BFD8515FC70B99"
} |
A4PES0 | This is Wee1-like protein kinase 2 protein, from Pig, contains 565 amino acids, locates in Nucleus. | [] | {
"primaryAccession": "A4PES0",
"organism_name": "Pig",
"protein_name": "Wee1-like protein kinase 2",
"length": 565,
"firstPublicDate": "2011-05-31T00:00:00",
"FUNCTION": "Oocyte-specific protein tyrosine kinase that phosphorylates and inhibits CDK1 and acts as a key regulator of meiosis during both prophase I and metaphase II, Required to maintain meiotic arrest in oocytes during the germinal vesicle (GV) stage, a long period of quiescence at dictyate prophase I, by phosphorylating CDK1 at 'Tyr-15', leading to inhibit CDK1 activity and prevent meiotic reentry, Also required for metaphase II exit during egg activation by phosphorylating CDK1 at 'Tyr-15', to ensure exit from meiosis in oocytes and promote pronuclear formation",
"SUBCELLULAR LOCATION": "Nucleus",
"SIMILARITY": "Belongs to the protein kinase superfamily, Ser/Thr protein kinase family, WEE1 subfamily",
"domain_description": {
"C2H2-type Zinc finger": null,
"C2H2-type; degenerate Zinc finger": null,
"Ig-like V-type Immunoglobulin domain": null,
"RING-type; degenerate Zinc finger": null,
"BED-type Zinc finger": null,
"Ig-like C2-type Immunoglobulin domain": null,
"C5HC2 Zinc finger": null,
"C2H2-type 2; degenerate Zinc finger": null,
"C2H2-type 5; degenerate Zinc finger": null,
"DBF4-type Zinc finger": null,
"RING-CH-type Zinc finger": null,
"NR C4-type Zinc finger": null,
"SP-RING-type Zinc finger": null,
"RING-type Zinc finger": null,
"UBZ4-type Zinc finger": null,
"Ig-like C1-type Immunoglobulin domain": null,
"C2HC MYST-type Zinc finger": null,
"RanBP2-type Zinc finger": null,
"Ig-like Immunoglobulin domain": null,
"C3H1-type Zinc finger": null,
"C4-type Zinc finger": null,
"CCHC-type Zinc finger": null,
"RING-type; atypical Zinc finger": null,
"TFIIS-type Zinc finger": null,
"C2H2-type 2; atypical Zinc finger": null,
"RRN7-type Zinc finger": null,
"C2H2-type 1; degenerate Zinc finger": null,
"GATA-type Zinc finger": null,
" Zinc finger": null,
"Phorbol-ester/DAG-type Zinc finger": null,
"CR-type Zinc finger": null,
"GATA-type; atypical Zinc finger": null,
"PHD-type; atypical Zinc finger": null,
"C2H2-type 4; atypical Zinc finger": null,
"B box-type; degenerate Zinc finger": null,
"CCHHC-type Zinc finger": null,
"C2H2-type; atypical Zinc finger": null,
"PHD-type Zinc finger": null,
"SGF11-type Zinc finger": null,
"HIT-type Zinc finger": null,
"C2H2-type 4; degenerate Zinc finger": null,
"FYVE-type; atypical Zinc finger": null,
"FCS-type Zinc finger": null,
"RING-Gid-type Zinc finger": null,
"B box-type 1; atypical Zinc finger": null,
"B box-type Zinc finger": null,
"DNL-type Zinc finger": null,
"CCHH-type Zinc finger": null,
"ZZ-type; degenerate Zinc finger": null,
"C2H2-type 11; degenerate Zinc finger": null,
"UBZ3-type Zinc finger": null,
"PHD-type 2; atypical Zinc finger": null,
"Matrin-type Zinc finger": null,
"MYND-type Zinc finger": null,
"B box-type 2; atypical Zinc finger": null,
"C2H2-type 1; atypical Zinc finger": null,
"TAZ-type Zinc finger": null,
"CHHC U11-48K-type Zinc finger": null,
"UBZ2-type Zinc finger": null,
"C2HC pre-PHD-type Zinc finger": null,
"PHD-type; degenerate Zinc finger": null,
"C2H2-type 3; atypical Zinc finger": null,
"FYVE-type 1; atypical Zinc finger": null,
"FYVE-type Zinc finger": null,
"PARP-type Zinc finger": null,
"Btk-type Zinc finger": null,
"CCHC-type 2; atypical Zinc finger": null,
"ZZ-type Zinc finger": null,
"PHD-type 2; degenerate Zinc finger": null,
"UBP-type; degenerate Zinc finger": null,
"THAP-type Zinc finger": null,
"3CxxC-type Zinc finger": null,
"C2H2-type 6; degenerate Zinc finger": null,
"C2H2-type 7; degenerate Zinc finger": null,
"C2H2-type 9; degenerate Zinc finger": null,
"C2H2-type 6; atypical Zinc finger": null,
"RTR1-type Zinc finger": null,
"CW-type Zinc finger": null,
"FLYWCH-type Zinc finger": null,
"C2H2-type 3; degenerate Zinc finger": null,
"C3HC-type Zinc finger": null,
"CCHHC-type; degenerate Zinc finger": null,
"UBP-type Zinc finger": null,
"UBZ1-type Zinc finger": null,
"B box-type; atypical Zinc finger": null,
"FPG-type Zinc finger": null,
"Dof-type Zinc finger": null,
"ZF-HD dimerization-type; degenerate Zinc finger": null,
"NF-X1-type Zinc finger": null,
"SWIM-type Zinc finger": null,
"C2H2-type 10; degenerate Zinc finger": null,
"C2H2-type 14; degenerate Zinc finger": null,
"CXXC-type Zinc finger": null,
"TFIIB-type Zinc finger": null,
"NOB1 Zinc finger": null,
"C2H2 AKAP95-type Zinc finger": null,
"A20-type Zinc finger": null,
"AN1-type Zinc finger": null,
"MYND-type; atypical Zinc finger": null,
"RING-type 1; atypical Zinc finger": null,
"RING-type 2; atypical Zinc finger": null,
"SIAH-type Zinc finger": null,
"MYND-type; degenerate Zinc finger": null,
"C2H2-type 11; atypical Zinc finger": null
},
"bin_loc": "U",
"split": "train"
} | {
"value": "MGDNGDNKELKQKLNFSYSEEEQEDEGQKEAQESKKVQYHTPERCGHQDSEAKFTPPRTPLNHVCELSTPQVKDRASPDQGLRTPVSRPHTRPETPAPPDKSKPPPHCESPFTPRGHSSQSVISTGKLPSRGSKHLRLTPGPLTDEMTSLALVNINPFTPESYRRQFLKSNGKRKTRRDLEEAGPEEGKVEKGLPAKRCVLRETNMACRYEKEFLEVEKIGVGEFGTVYKCIKRLDGCVYAIKRSTKPVSGLSDENLAMHEVYAHSVLGHHPHVVRYYSSWAEDDHMMIQNEYCNGGSLQAAISENAKSGNHFQEPKLKDILLQISLGLKYIHNYGMVHMDIKPSNIFICHKIPSDSPVVPEEAENEADWFLSANVTYKIGDLGHVTSISEPQVEEGDSRFLAKEILQENYQHLPKADIFALGLTIAVAAGAEALPTNGTSWHHIREGQLPNIPQDLSKEFYNLLKDMIDPDPVARPSAAALTRSRVLCPSLGRTEELQQQLNLEKFKTATLERELKEVQRAQSSKEGQSSPGVTGTHTGSRSTRRLVGGKSAKSSSFTWGQSSP",
"length": 565,
"molWeight": 62928,
"crc64": "2855273D6B1548BC",
"md5": "6B77C407B8D7D4E296494B84538CDF21"
} |
A4QUT2 | This is Catalase-peroxidase 2 protein, from Rice blast fungus, contains 786 amino acids, is soluble, locates in Extracellular. | [] | {
"primaryAccession": "A4QUT2",
"organism_name": "Rice blast fungus",
"protein_name": "Catalase-peroxidase 2",
"length": 786,
"firstPublicDate": "2008-07-22T00:00:00",
"FUNCTION": "Bifunctional enzyme with both catalase and broad-spectrum peroxidase activity, Confers resistance to H(2)O(2) in hyphae, May play an antioxidative role in fungal defense against the host-produced H(2)O(2) (oxidative burst) at the early stage of plant infection",
"SUBCELLULAR LOCATION": "Extracellular",
"SIMILARITY": "Belongs to the peroxidase family, Peroxidase/catalase subfamily",
"domain_description": {
"C2H2-type Zinc finger": null,
"C2H2-type; degenerate Zinc finger": null,
"Ig-like V-type Immunoglobulin domain": null,
"RING-type; degenerate Zinc finger": null,
"BED-type Zinc finger": null,
"Ig-like C2-type Immunoglobulin domain": null,
"C5HC2 Zinc finger": null,
"C2H2-type 2; degenerate Zinc finger": null,
"C2H2-type 5; degenerate Zinc finger": null,
"DBF4-type Zinc finger": null,
"RING-CH-type Zinc finger": null,
"NR C4-type Zinc finger": null,
"SP-RING-type Zinc finger": null,
"RING-type Zinc finger": null,
"UBZ4-type Zinc finger": null,
"Ig-like C1-type Immunoglobulin domain": null,
"C2HC MYST-type Zinc finger": null,
"RanBP2-type Zinc finger": null,
"Ig-like Immunoglobulin domain": null,
"C3H1-type Zinc finger": null,
"C4-type Zinc finger": null,
"CCHC-type Zinc finger": null,
"RING-type; atypical Zinc finger": null,
"TFIIS-type Zinc finger": null,
"C2H2-type 2; atypical Zinc finger": null,
"RRN7-type Zinc finger": null,
"C2H2-type 1; degenerate Zinc finger": null,
"GATA-type Zinc finger": null,
" Zinc finger": null,
"Phorbol-ester/DAG-type Zinc finger": null,
"CR-type Zinc finger": null,
"GATA-type; atypical Zinc finger": null,
"PHD-type; atypical Zinc finger": null,
"C2H2-type 4; atypical Zinc finger": null,
"B box-type; degenerate Zinc finger": null,
"CCHHC-type Zinc finger": null,
"C2H2-type; atypical Zinc finger": null,
"PHD-type Zinc finger": null,
"SGF11-type Zinc finger": null,
"HIT-type Zinc finger": null,
"C2H2-type 4; degenerate Zinc finger": null,
"FYVE-type; atypical Zinc finger": null,
"FCS-type Zinc finger": null,
"RING-Gid-type Zinc finger": null,
"B box-type 1; atypical Zinc finger": null,
"B box-type Zinc finger": null,
"DNL-type Zinc finger": null,
"CCHH-type Zinc finger": null,
"ZZ-type; degenerate Zinc finger": null,
"C2H2-type 11; degenerate Zinc finger": null,
"UBZ3-type Zinc finger": null,
"PHD-type 2; atypical Zinc finger": null,
"Matrin-type Zinc finger": null,
"MYND-type Zinc finger": null,
"B box-type 2; atypical Zinc finger": null,
"C2H2-type 1; atypical Zinc finger": null,
"TAZ-type Zinc finger": null,
"CHHC U11-48K-type Zinc finger": null,
"UBZ2-type Zinc finger": null,
"C2HC pre-PHD-type Zinc finger": null,
"PHD-type; degenerate Zinc finger": null,
"C2H2-type 3; atypical Zinc finger": null,
"FYVE-type 1; atypical Zinc finger": null,
"FYVE-type Zinc finger": null,
"PARP-type Zinc finger": null,
"Btk-type Zinc finger": null,
"CCHC-type 2; atypical Zinc finger": null,
"ZZ-type Zinc finger": null,
"PHD-type 2; degenerate Zinc finger": null,
"UBP-type; degenerate Zinc finger": null,
"THAP-type Zinc finger": null,
"3CxxC-type Zinc finger": null,
"C2H2-type 6; degenerate Zinc finger": null,
"C2H2-type 7; degenerate Zinc finger": null,
"C2H2-type 9; degenerate Zinc finger": null,
"C2H2-type 6; atypical Zinc finger": null,
"RTR1-type Zinc finger": null,
"CW-type Zinc finger": null,
"FLYWCH-type Zinc finger": null,
"C2H2-type 3; degenerate Zinc finger": null,
"C3HC-type Zinc finger": null,
"CCHHC-type; degenerate Zinc finger": null,
"UBP-type Zinc finger": null,
"UBZ1-type Zinc finger": null,
"B box-type; atypical Zinc finger": null,
"FPG-type Zinc finger": null,
"Dof-type Zinc finger": null,
"ZF-HD dimerization-type; degenerate Zinc finger": null,
"NF-X1-type Zinc finger": null,
"SWIM-type Zinc finger": null,
"C2H2-type 10; degenerate Zinc finger": null,
"C2H2-type 14; degenerate Zinc finger": null,
"CXXC-type Zinc finger": null,
"TFIIB-type Zinc finger": null,
"NOB1 Zinc finger": null,
"C2H2 AKAP95-type Zinc finger": null,
"A20-type Zinc finger": null,
"AN1-type Zinc finger": null,
"MYND-type; atypical Zinc finger": null,
"RING-type 1; atypical Zinc finger": null,
"RING-type 2; atypical Zinc finger": null,
"SIAH-type Zinc finger": null,
"MYND-type; degenerate Zinc finger": null,
"C2H2-type 11; atypical Zinc finger": null
},
"bin_loc": "S",
"split": "train"
} | {
"value": "MHASLSSWLLAASLLTQPISVSGQGCPFAKRDGTVDSSLPQKRADAPETTTFGRCAVKSNQAGGGTRSHDWWPCQLRLDVLRQFQPSQNPLGGDFDYAEAFQSLDYEAVKKDIAALMTESQDWWPADFGNYGGLFVRMAWHSAGTYRAMDGRGGGGMGQQRFAPLNSWPDNQNLDKARRLIWPIKQKYGNKISWADLMLLTGNVALENMGFKTLGFGGGRADTWQSDEAVYWGAETTFVPQGNDVRYNNSVDINARADKLEKPLAATHMGLIYVNPEGPNGTPDPAASAKDIREAFGRMGMNDTETVALIAGGHAFGKTHGAVKGSNIGPAPEAADLGMQGLGWHNSVGDGNGPNQMTSGLEVIWTKTPTKWSNGYLESLINNNWTLVESPAGAHQWEAVNGTVDYPDPFDKTKFRKATMLTSDLALINDPEYLKISQRWLEHPEELADAFAKAWFKLLHRDLGPTTRYLGPEVPKESFIWQDPLPAREGDLIDDADVDKLKAAILSTDGLDVSKLASTAMACATTYRNSDKRGGCNGARIALEPQRNWVSNNPTQLSAVLDALKKVQSDFNGSNGNKKVSLADLIVLGGTAAVEKAAKDAGVDIKVPFSAGRVDATQEQTDVTQFSYLEPQADGFRNYGRGTARARTEEIMVDKASQLTLTPPELTVLVGGMRALGANYDGSDVGVFTANKGKLTPDFFVNLVDMNIAWTASGADGESWVGTDRKSRSEKYKGSRADLVFGSHAELRAIAEVYAENGNQEKFVKDFVAAWTKVMNLDRFDLKVKK",
"length": 786,
"molWeight": 85587,
"crc64": "2A6C8B2B043C3879",
"md5": "12B03BAD299A205BE9F02C8A1DF6E996"
} |
A4VCL2 | This is Extracellular serine/threonine protein CG31145 protein, from Fruit fly, contains 528 amino acids, is membrane-bound, locates in Golgi apparatus. | [] | {
"primaryAccession": "A4VCL2",
"organism_name": "Fruit fly",
"protein_name": "Extracellular serine/threonine protein CG31145",
"length": 528,
"firstPublicDate": "2015-07-22T00:00:00",
"FUNCTION": "Golgi serine/threonine protein kinase that phosphorylates secretory pathway proteins within Ser-x-Glu/pSer motifs",
"SUBCELLULAR LOCATION": "Golgi apparatus",
"SIMILARITY": "Belongs to the FAM20 family",
"domain_description": {
"C2H2-type Zinc finger": null,
"C2H2-type; degenerate Zinc finger": null,
"Ig-like V-type Immunoglobulin domain": null,
"RING-type; degenerate Zinc finger": null,
"BED-type Zinc finger": null,
"Ig-like C2-type Immunoglobulin domain": null,
"C5HC2 Zinc finger": null,
"C2H2-type 2; degenerate Zinc finger": null,
"C2H2-type 5; degenerate Zinc finger": null,
"DBF4-type Zinc finger": null,
"RING-CH-type Zinc finger": null,
"NR C4-type Zinc finger": null,
"SP-RING-type Zinc finger": null,
"RING-type Zinc finger": null,
"UBZ4-type Zinc finger": null,
"Ig-like C1-type Immunoglobulin domain": null,
"C2HC MYST-type Zinc finger": null,
"RanBP2-type Zinc finger": null,
"Ig-like Immunoglobulin domain": null,
"C3H1-type Zinc finger": null,
"C4-type Zinc finger": null,
"CCHC-type Zinc finger": null,
"RING-type; atypical Zinc finger": null,
"TFIIS-type Zinc finger": null,
"C2H2-type 2; atypical Zinc finger": null,
"RRN7-type Zinc finger": null,
"C2H2-type 1; degenerate Zinc finger": null,
"GATA-type Zinc finger": null,
" Zinc finger": null,
"Phorbol-ester/DAG-type Zinc finger": null,
"CR-type Zinc finger": null,
"GATA-type; atypical Zinc finger": null,
"PHD-type; atypical Zinc finger": null,
"C2H2-type 4; atypical Zinc finger": null,
"B box-type; degenerate Zinc finger": null,
"CCHHC-type Zinc finger": null,
"C2H2-type; atypical Zinc finger": null,
"PHD-type Zinc finger": null,
"SGF11-type Zinc finger": null,
"HIT-type Zinc finger": null,
"C2H2-type 4; degenerate Zinc finger": null,
"FYVE-type; atypical Zinc finger": null,
"FCS-type Zinc finger": null,
"RING-Gid-type Zinc finger": null,
"B box-type 1; atypical Zinc finger": null,
"B box-type Zinc finger": null,
"DNL-type Zinc finger": null,
"CCHH-type Zinc finger": null,
"ZZ-type; degenerate Zinc finger": null,
"C2H2-type 11; degenerate Zinc finger": null,
"UBZ3-type Zinc finger": null,
"PHD-type 2; atypical Zinc finger": null,
"Matrin-type Zinc finger": null,
"MYND-type Zinc finger": null,
"B box-type 2; atypical Zinc finger": null,
"C2H2-type 1; atypical Zinc finger": null,
"TAZ-type Zinc finger": null,
"CHHC U11-48K-type Zinc finger": null,
"UBZ2-type Zinc finger": null,
"C2HC pre-PHD-type Zinc finger": null,
"PHD-type; degenerate Zinc finger": null,
"C2H2-type 3; atypical Zinc finger": null,
"FYVE-type 1; atypical Zinc finger": null,
"FYVE-type Zinc finger": null,
"PARP-type Zinc finger": null,
"Btk-type Zinc finger": null,
"CCHC-type 2; atypical Zinc finger": null,
"ZZ-type Zinc finger": null,
"PHD-type 2; degenerate Zinc finger": null,
"UBP-type; degenerate Zinc finger": null,
"THAP-type Zinc finger": null,
"3CxxC-type Zinc finger": null,
"C2H2-type 6; degenerate Zinc finger": null,
"C2H2-type 7; degenerate Zinc finger": null,
"C2H2-type 9; degenerate Zinc finger": null,
"C2H2-type 6; atypical Zinc finger": null,
"RTR1-type Zinc finger": null,
"CW-type Zinc finger": null,
"FLYWCH-type Zinc finger": null,
"C2H2-type 3; degenerate Zinc finger": null,
"C3HC-type Zinc finger": null,
"CCHHC-type; degenerate Zinc finger": null,
"UBP-type Zinc finger": null,
"UBZ1-type Zinc finger": null,
"B box-type; atypical Zinc finger": null,
"FPG-type Zinc finger": null,
"Dof-type Zinc finger": null,
"ZF-HD dimerization-type; degenerate Zinc finger": null,
"NF-X1-type Zinc finger": null,
"SWIM-type Zinc finger": null,
"C2H2-type 10; degenerate Zinc finger": null,
"C2H2-type 14; degenerate Zinc finger": null,
"CXXC-type Zinc finger": null,
"TFIIB-type Zinc finger": null,
"NOB1 Zinc finger": null,
"C2H2 AKAP95-type Zinc finger": null,
"A20-type Zinc finger": null,
"AN1-type Zinc finger": null,
"MYND-type; atypical Zinc finger": null,
"RING-type 1; atypical Zinc finger": null,
"RING-type 2; atypical Zinc finger": null,
"SIAH-type Zinc finger": null,
"MYND-type; degenerate Zinc finger": null,
"C2H2-type 11; atypical Zinc finger": null
},
"bin_loc": "M",
"split": "train"
} | {
"value": "MAVLRTMKLKERLVISLGATLVLLTLLLIVDVQMDFGVANRHLLQQQHQKIRLGNDYDGGTGGGGMLHEFKRKFLQKSNASGSKEASTQAGASQSGGATSGQDAAAGASGGAAGPGTSRSTSTRKPTPHDRYADLQKHLLSDEYSHVIVDNAPDVSRDNPTLAEMLHRKASANASNLERFQLRITKKELYGEQDTLVDAVLRDMIKLPIQHVVQKEGGTQLKLIIEYPNDIKALMKPMRFPREQQTLPNHFYFTDYERHNAEIAAFHLDRILGFRRAMPVAGRTLNITTEIYQLAEENLLKTFFVSPSLNLCFHGKCSYYCDTSHAICGNPDMLEGSFAAFLPNFESGNRKLWRHPWRRSYHKRKKAQWETDANYCALVRDIPPYDDGRRLYDLMDMAVFDFLTGNMDRHHYETFKVYGNETFPLHLDHGRGFGRPFHDELSILAPVLQCCLIRKSTLVKLLDFHNGPKPLSQLMSESLSQDPVSPVLWQPHLEALDRRTGIILQSIRDCIKRNPPGDVDGSETDVSS",
"length": 528,
"molWeight": 59415,
"crc64": "9078A2AB880C791F",
"md5": "0EC52E20A283F63222E34043D6DECCFE"
} |
A5JUY8 | This is Lactoperoxidase protein, from Domestic water buffalo, contains 712 amino acids, is soluble, locates in Extracellular. | [] | {
"primaryAccession": "A5JUY8",
"organism_name": "Domestic water buffalo",
"protein_name": "Lactoperoxidase",
"length": 712,
"firstPublicDate": "2014-01-22T00:00:00",
"FUNCTION": "Heme-containing oxidoreductase which catalyzes the conversion of thiocyanate (SCN(-)) into antimicrobial agent hypothiocyanous acid (OSCN(-)) in the presence of hydrogen peroxide (H2O2) (Probable), Also involved in the conversion of iodide (I(-)) into hypoiodite (IO(-)) in the presence of H2O2 (By similarity), Responsible for the inactivation of a wide range of micro-organisms and hence, important component of defense mechanism (PubMed:12071645), Shows antibacterial properties against E,coli, K,pneumoniae, P,aeruginosa, S,sonnei, S,saphrophyticus, S,epidermidis and S,dysenteriae (PubMed:12071645), May protect the udder from infection and may promote growth in newborns (By similarity), May be implicated in airway host defense against infection (By similarity), May contribute to maintaining an appropriate H2O2 cellular level, therefore protecting cells from H2O2-caused injuries and inflammation (By similarity)",
"SUBCELLULAR LOCATION": "Extracellular",
"SIMILARITY": "Belongs to the peroxidase family, XPO subfamily",
"domain_description": {
"C2H2-type Zinc finger": null,
"C2H2-type; degenerate Zinc finger": null,
"Ig-like V-type Immunoglobulin domain": null,
"RING-type; degenerate Zinc finger": null,
"BED-type Zinc finger": null,
"Ig-like C2-type Immunoglobulin domain": null,
"C5HC2 Zinc finger": null,
"C2H2-type 2; degenerate Zinc finger": null,
"C2H2-type 5; degenerate Zinc finger": null,
"DBF4-type Zinc finger": null,
"RING-CH-type Zinc finger": null,
"NR C4-type Zinc finger": null,
"SP-RING-type Zinc finger": null,
"RING-type Zinc finger": null,
"UBZ4-type Zinc finger": null,
"Ig-like C1-type Immunoglobulin domain": null,
"C2HC MYST-type Zinc finger": null,
"RanBP2-type Zinc finger": null,
"Ig-like Immunoglobulin domain": null,
"C3H1-type Zinc finger": null,
"C4-type Zinc finger": null,
"CCHC-type Zinc finger": null,
"RING-type; atypical Zinc finger": null,
"TFIIS-type Zinc finger": null,
"C2H2-type 2; atypical Zinc finger": null,
"RRN7-type Zinc finger": null,
"C2H2-type 1; degenerate Zinc finger": null,
"GATA-type Zinc finger": null,
" Zinc finger": null,
"Phorbol-ester/DAG-type Zinc finger": null,
"CR-type Zinc finger": null,
"GATA-type; atypical Zinc finger": null,
"PHD-type; atypical Zinc finger": null,
"C2H2-type 4; atypical Zinc finger": null,
"B box-type; degenerate Zinc finger": null,
"CCHHC-type Zinc finger": null,
"C2H2-type; atypical Zinc finger": null,
"PHD-type Zinc finger": null,
"SGF11-type Zinc finger": null,
"HIT-type Zinc finger": null,
"C2H2-type 4; degenerate Zinc finger": null,
"FYVE-type; atypical Zinc finger": null,
"FCS-type Zinc finger": null,
"RING-Gid-type Zinc finger": null,
"B box-type 1; atypical Zinc finger": null,
"B box-type Zinc finger": null,
"DNL-type Zinc finger": null,
"CCHH-type Zinc finger": null,
"ZZ-type; degenerate Zinc finger": null,
"C2H2-type 11; degenerate Zinc finger": null,
"UBZ3-type Zinc finger": null,
"PHD-type 2; atypical Zinc finger": null,
"Matrin-type Zinc finger": null,
"MYND-type Zinc finger": null,
"B box-type 2; atypical Zinc finger": null,
"C2H2-type 1; atypical Zinc finger": null,
"TAZ-type Zinc finger": null,
"CHHC U11-48K-type Zinc finger": null,
"UBZ2-type Zinc finger": null,
"C2HC pre-PHD-type Zinc finger": null,
"PHD-type; degenerate Zinc finger": null,
"C2H2-type 3; atypical Zinc finger": null,
"FYVE-type 1; atypical Zinc finger": null,
"FYVE-type Zinc finger": null,
"PARP-type Zinc finger": null,
"Btk-type Zinc finger": null,
"CCHC-type 2; atypical Zinc finger": null,
"ZZ-type Zinc finger": null,
"PHD-type 2; degenerate Zinc finger": null,
"UBP-type; degenerate Zinc finger": null,
"THAP-type Zinc finger": null,
"3CxxC-type Zinc finger": null,
"C2H2-type 6; degenerate Zinc finger": null,
"C2H2-type 7; degenerate Zinc finger": null,
"C2H2-type 9; degenerate Zinc finger": null,
"C2H2-type 6; atypical Zinc finger": null,
"RTR1-type Zinc finger": null,
"CW-type Zinc finger": null,
"FLYWCH-type Zinc finger": null,
"C2H2-type 3; degenerate Zinc finger": null,
"C3HC-type Zinc finger": null,
"CCHHC-type; degenerate Zinc finger": null,
"UBP-type Zinc finger": null,
"UBZ1-type Zinc finger": null,
"B box-type; atypical Zinc finger": null,
"FPG-type Zinc finger": null,
"Dof-type Zinc finger": null,
"ZF-HD dimerization-type; degenerate Zinc finger": null,
"NF-X1-type Zinc finger": null,
"SWIM-type Zinc finger": null,
"C2H2-type 10; degenerate Zinc finger": null,
"C2H2-type 14; degenerate Zinc finger": null,
"CXXC-type Zinc finger": null,
"TFIIB-type Zinc finger": null,
"NOB1 Zinc finger": null,
"C2H2 AKAP95-type Zinc finger": null,
"A20-type Zinc finger": null,
"AN1-type Zinc finger": null,
"MYND-type; atypical Zinc finger": null,
"RING-type 1; atypical Zinc finger": null,
"RING-type 2; atypical Zinc finger": null,
"SIAH-type Zinc finger": null,
"MYND-type; degenerate Zinc finger": null,
"C2H2-type 11; atypical Zinc finger": null
},
"bin_loc": "S",
"split": "train"
} | {
"value": "MWVCLQLPVFLASVTLFEVAASDTIAQAASTTTISDAVSKVKIQVNKAFLDSRTRLKTTLSSEAPTTQQLSEYFKHAKGQTRTAIRNGQVWEESFKRLRRDTTLTNVTDPSLDLTALSWEVGCGAPVPLVKCDENSPYRTITGDCNNRRSPALGAANRALARWLPAEYEDGLALPFGWTQRKTRNGFRVPLAREVSNKIVGYLDEEGVLDQNRSLLFMQWGQIVDHDLDFAPETELGSNEHSKTQCEEYCIQGDNCFPIMFPKNDPKLKTQGKCMPFFRAGFVCPTPPYQSLAREQINAVTSFLDASLVYGSEPSLASRLRNLSSPLGLMAVNQEAWDHGLAYLPFNNKKPSPCEFINTTARVPCFLAGDFRASEQILLATAHTLLLREHNRLARELKKLNPHWNGEKLYQEARKILGAFIQIITFRDYLPIVLGSEMQKWIPPYQGYNNSVDPRISNVFTFAFRFGHMEVPSTVSRLDENYQPWGPEAELPLHTLFFNTWRIIKDGGIDPLTRGLLAKKSKLMNQDKMVTSELRNKLFQPTHKIHGFDLAAINLQRCRDHGMPGYNSWRGFCGLSQPKTLKGLQTVLKNKILAKKLMDLYKTPDNIDIWIGGNAEPMVERGRVGPLLACLLGRQFQQIRDGDRFWWENPGVFTEKQRDSLQKFSFSRLICDNTHITKVPLHAFQANNYPHDFVDCSTVDKLDLSPWASREN",
"length": 712,
"molWeight": 80698,
"crc64": "426BF93704E7309B",
"md5": "C27A58D2306166AB0D488862460D0D21"
} |
A5PLL7 | This is Plasmanylethanolamine desaturase 1 protein, from Human, contains 270 amino acids, is membrane-bound, locates in Endoplasmic reticulum. | [] | {
"primaryAccession": "A5PLL7",
"organism_name": "Human",
"protein_name": "Plasmanylethanolamine desaturase 1",
"length": 270,
"firstPublicDate": "2008-02-26T00:00:00",
"FUNCTION": "Plasmanylethanolamine desaturase involved in plasmalogen biogenesis in the endoplasmic reticulum membrane (PubMed:31604315, PubMed:32209662), Plasmalogens are glycerophospholipids with a hydrocarbon chain linked by a vinyl ether bond at the glycerol sn-1 position, and are involved in antioxidative and signaling mechanisms (PubMed:31604315)",
"SUBCELLULAR LOCATION": "Endoplasmic reticulum",
"SIMILARITY": "Belongs to the fatty acid desaturase CarF family",
"domain_description": {
"C2H2-type Zinc finger": null,
"C2H2-type; degenerate Zinc finger": null,
"Ig-like V-type Immunoglobulin domain": null,
"RING-type; degenerate Zinc finger": null,
"BED-type Zinc finger": null,
"Ig-like C2-type Immunoglobulin domain": null,
"C5HC2 Zinc finger": null,
"C2H2-type 2; degenerate Zinc finger": null,
"C2H2-type 5; degenerate Zinc finger": null,
"DBF4-type Zinc finger": null,
"RING-CH-type Zinc finger": null,
"NR C4-type Zinc finger": null,
"SP-RING-type Zinc finger": null,
"RING-type Zinc finger": null,
"UBZ4-type Zinc finger": null,
"Ig-like C1-type Immunoglobulin domain": null,
"C2HC MYST-type Zinc finger": null,
"RanBP2-type Zinc finger": null,
"Ig-like Immunoglobulin domain": null,
"C3H1-type Zinc finger": null,
"C4-type Zinc finger": null,
"CCHC-type Zinc finger": null,
"RING-type; atypical Zinc finger": null,
"TFIIS-type Zinc finger": null,
"C2H2-type 2; atypical Zinc finger": null,
"RRN7-type Zinc finger": null,
"C2H2-type 1; degenerate Zinc finger": null,
"GATA-type Zinc finger": null,
" Zinc finger": null,
"Phorbol-ester/DAG-type Zinc finger": null,
"CR-type Zinc finger": null,
"GATA-type; atypical Zinc finger": null,
"PHD-type; atypical Zinc finger": null,
"C2H2-type 4; atypical Zinc finger": null,
"B box-type; degenerate Zinc finger": null,
"CCHHC-type Zinc finger": null,
"C2H2-type; atypical Zinc finger": null,
"PHD-type Zinc finger": null,
"SGF11-type Zinc finger": null,
"HIT-type Zinc finger": null,
"C2H2-type 4; degenerate Zinc finger": null,
"FYVE-type; atypical Zinc finger": null,
"FCS-type Zinc finger": null,
"RING-Gid-type Zinc finger": null,
"B box-type 1; atypical Zinc finger": null,
"B box-type Zinc finger": null,
"DNL-type Zinc finger": null,
"CCHH-type Zinc finger": null,
"ZZ-type; degenerate Zinc finger": null,
"C2H2-type 11; degenerate Zinc finger": null,
"UBZ3-type Zinc finger": null,
"PHD-type 2; atypical Zinc finger": null,
"Matrin-type Zinc finger": null,
"MYND-type Zinc finger": null,
"B box-type 2; atypical Zinc finger": null,
"C2H2-type 1; atypical Zinc finger": null,
"TAZ-type Zinc finger": null,
"CHHC U11-48K-type Zinc finger": null,
"UBZ2-type Zinc finger": null,
"C2HC pre-PHD-type Zinc finger": null,
"PHD-type; degenerate Zinc finger": null,
"C2H2-type 3; atypical Zinc finger": null,
"FYVE-type 1; atypical Zinc finger": null,
"FYVE-type Zinc finger": null,
"PARP-type Zinc finger": null,
"Btk-type Zinc finger": null,
"CCHC-type 2; atypical Zinc finger": null,
"ZZ-type Zinc finger": null,
"PHD-type 2; degenerate Zinc finger": null,
"UBP-type; degenerate Zinc finger": null,
"THAP-type Zinc finger": null,
"3CxxC-type Zinc finger": null,
"C2H2-type 6; degenerate Zinc finger": null,
"C2H2-type 7; degenerate Zinc finger": null,
"C2H2-type 9; degenerate Zinc finger": null,
"C2H2-type 6; atypical Zinc finger": null,
"RTR1-type Zinc finger": null,
"CW-type Zinc finger": null,
"FLYWCH-type Zinc finger": null,
"C2H2-type 3; degenerate Zinc finger": null,
"C3HC-type Zinc finger": null,
"CCHHC-type; degenerate Zinc finger": null,
"UBP-type Zinc finger": null,
"UBZ1-type Zinc finger": null,
"B box-type; atypical Zinc finger": null,
"FPG-type Zinc finger": null,
"Dof-type Zinc finger": null,
"ZF-HD dimerization-type; degenerate Zinc finger": null,
"NF-X1-type Zinc finger": null,
"SWIM-type Zinc finger": null,
"C2H2-type 10; degenerate Zinc finger": null,
"C2H2-type 14; degenerate Zinc finger": null,
"CXXC-type Zinc finger": null,
"TFIIB-type Zinc finger": null,
"NOB1 Zinc finger": null,
"C2H2 AKAP95-type Zinc finger": null,
"A20-type Zinc finger": null,
"AN1-type Zinc finger": null,
"MYND-type; atypical Zinc finger": null,
"RING-type 1; atypical Zinc finger": null,
"RING-type 2; atypical Zinc finger": null,
"SIAH-type Zinc finger": null,
"MYND-type; degenerate Zinc finger": null,
"C2H2-type 11; atypical Zinc finger": null
},
"bin_loc": "M",
"split": "train"
} | {
"value": "MAGAENWPGQQLELDEDEASCCRWGAQHAGARELAALYSPGKRLQEWCSVILCFSLIAHNLVHLLLLARWEDTPLVILGVVAGALIADFLSGLVHWGADTWGSVELPIVGKAFIRPFREHHIDPTAITRHDFIETNGDNCLVTLLPLLNMAYKFRTHSPEALEQLYPWECFVFCLIIFGTFTNQIHKWSHTYFGLPRWVTLLQDWHVILPRKHHRIHHVSPHETYFCITTGWLNYPLEKIGFWRRLEDLIQGLTGEKPRADDMKWAQKIK",
"length": 270,
"molWeight": 31135,
"crc64": "960E639B6F1B55ED",
"md5": "833F1A005E36C79C928BB21845023D91"
} |
A5X5Y0 | This is 5-hydroxytryptamine receptor 3E protein, from Human, contains 456 amino acids, is membrane-bound, locates in Cell membrane. | [] | {
"primaryAccession": "A5X5Y0",
"organism_name": "Human",
"protein_name": "5-hydroxytryptamine receptor 3E",
"length": 456,
"firstPublicDate": "2007-12-04T00:00:00",
"FUNCTION": "This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen, This receptor is a ligand-gated ion channel, which when activated causes fast, depolarizing responses, It is a cation-specific, but otherwise relatively nonselective, ion channel",
"SUBCELLULAR LOCATION": "Cell membrane",
"SIMILARITY": "Belongs to the ligand-gated ion channel (TC 1,A,9) family, 5-hydroxytryptamine receptor (TC 1,A,9,2) subfamily, HTR3E sub-subfamily",
"domain_description": {
"C2H2-type Zinc finger": null,
"C2H2-type; degenerate Zinc finger": null,
"Ig-like V-type Immunoglobulin domain": null,
"RING-type; degenerate Zinc finger": null,
"BED-type Zinc finger": null,
"Ig-like C2-type Immunoglobulin domain": null,
"C5HC2 Zinc finger": null,
"C2H2-type 2; degenerate Zinc finger": null,
"C2H2-type 5; degenerate Zinc finger": null,
"DBF4-type Zinc finger": null,
"RING-CH-type Zinc finger": null,
"NR C4-type Zinc finger": null,
"SP-RING-type Zinc finger": null,
"RING-type Zinc finger": null,
"UBZ4-type Zinc finger": null,
"Ig-like C1-type Immunoglobulin domain": null,
"C2HC MYST-type Zinc finger": null,
"RanBP2-type Zinc finger": null,
"Ig-like Immunoglobulin domain": null,
"C3H1-type Zinc finger": null,
"C4-type Zinc finger": null,
"CCHC-type Zinc finger": null,
"RING-type; atypical Zinc finger": null,
"TFIIS-type Zinc finger": null,
"C2H2-type 2; atypical Zinc finger": null,
"RRN7-type Zinc finger": null,
"C2H2-type 1; degenerate Zinc finger": null,
"GATA-type Zinc finger": null,
" Zinc finger": null,
"Phorbol-ester/DAG-type Zinc finger": null,
"CR-type Zinc finger": null,
"GATA-type; atypical Zinc finger": null,
"PHD-type; atypical Zinc finger": null,
"C2H2-type 4; atypical Zinc finger": null,
"B box-type; degenerate Zinc finger": null,
"CCHHC-type Zinc finger": null,
"C2H2-type; atypical Zinc finger": null,
"PHD-type Zinc finger": null,
"SGF11-type Zinc finger": null,
"HIT-type Zinc finger": null,
"C2H2-type 4; degenerate Zinc finger": null,
"FYVE-type; atypical Zinc finger": null,
"FCS-type Zinc finger": null,
"RING-Gid-type Zinc finger": null,
"B box-type 1; atypical Zinc finger": null,
"B box-type Zinc finger": null,
"DNL-type Zinc finger": null,
"CCHH-type Zinc finger": null,
"ZZ-type; degenerate Zinc finger": null,
"C2H2-type 11; degenerate Zinc finger": null,
"UBZ3-type Zinc finger": null,
"PHD-type 2; atypical Zinc finger": null,
"Matrin-type Zinc finger": null,
"MYND-type Zinc finger": null,
"B box-type 2; atypical Zinc finger": null,
"C2H2-type 1; atypical Zinc finger": null,
"TAZ-type Zinc finger": null,
"CHHC U11-48K-type Zinc finger": null,
"UBZ2-type Zinc finger": null,
"C2HC pre-PHD-type Zinc finger": null,
"PHD-type; degenerate Zinc finger": null,
"C2H2-type 3; atypical Zinc finger": null,
"FYVE-type 1; atypical Zinc finger": null,
"FYVE-type Zinc finger": null,
"PARP-type Zinc finger": null,
"Btk-type Zinc finger": null,
"CCHC-type 2; atypical Zinc finger": null,
"ZZ-type Zinc finger": null,
"PHD-type 2; degenerate Zinc finger": null,
"UBP-type; degenerate Zinc finger": null,
"THAP-type Zinc finger": null,
"3CxxC-type Zinc finger": null,
"C2H2-type 6; degenerate Zinc finger": null,
"C2H2-type 7; degenerate Zinc finger": null,
"C2H2-type 9; degenerate Zinc finger": null,
"C2H2-type 6; atypical Zinc finger": null,
"RTR1-type Zinc finger": null,
"CW-type Zinc finger": null,
"FLYWCH-type Zinc finger": null,
"C2H2-type 3; degenerate Zinc finger": null,
"C3HC-type Zinc finger": null,
"CCHHC-type; degenerate Zinc finger": null,
"UBP-type Zinc finger": null,
"UBZ1-type Zinc finger": null,
"B box-type; atypical Zinc finger": null,
"FPG-type Zinc finger": null,
"Dof-type Zinc finger": null,
"ZF-HD dimerization-type; degenerate Zinc finger": null,
"NF-X1-type Zinc finger": null,
"SWIM-type Zinc finger": null,
"C2H2-type 10; degenerate Zinc finger": null,
"C2H2-type 14; degenerate Zinc finger": null,
"CXXC-type Zinc finger": null,
"TFIIB-type Zinc finger": null,
"NOB1 Zinc finger": null,
"C2H2 AKAP95-type Zinc finger": null,
"A20-type Zinc finger": null,
"AN1-type Zinc finger": null,
"MYND-type; atypical Zinc finger": null,
"RING-type 1; atypical Zinc finger": null,
"RING-type 2; atypical Zinc finger": null,
"SIAH-type Zinc finger": null,
"MYND-type; degenerate Zinc finger": null,
"C2H2-type 11; atypical Zinc finger": null
},
"bin_loc": "M",
"split": "train"
} | {
"value": "MEGSWFHRKRFSFYLLLGFLLQGRGVTFTINCSGFGQHGADPTALNSVFNRKPFRPVTNISVPTQVNISFAMSAILDVNEQLHLLSSFLWLEMVWDNPFISWNPEECEGITKMSMAAKNLWLPDIFIIELMDVDKTPKGLTAYVSNEGRIRYKKPMKVDSICNLDIFYFPFDQQNCTLTFSSFLYTVDSMLLDMEKEVWEITDASRNILQTHGEWELLGLSKATAKLSRGGNLYDQIVFYVAIRRRPSLYVINLLVPSGFLVAIDALSFYLPVKSGNRVPFKITLLLGYNVFLLMMSDLLPTSGTPLIGVYFALCLSLMVGSLLETIFITHLLHVATTQPPPLPRWLHSLLLHCNSPGRCCPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPGPAEAELTGGSEWTRAQREHEAQKQHSVELWLQFSHAMDAMLFRLYLLFMASSIITVICLWNT",
"length": 456,
"molWeight": 51438,
"crc64": "4BFA6561BA309E83",
"md5": "5C0F7D419E90BFE8EB934483F4543F7B"
} |
A6H687 | This is SAC3 domain-containing protein 1 protein, from Mouse, contains 427 amino acids, is soluble, locates in Cytoplasm. | [] | {
"primaryAccession": "A6H687",
"organism_name": "Mouse",
"protein_name": "SAC3 domain-containing protein 1",
"length": 427,
"firstPublicDate": "2007-10-23T00:00:00",
"FUNCTION": "Involved in centrosome duplication and mitotic progression",
"SUBCELLULAR LOCATION": "Cytoplasm",
"SIMILARITY": "Belongs to the SAC3 family",
"domain_description": {
"C2H2-type Zinc finger": null,
"C2H2-type; degenerate Zinc finger": null,
"Ig-like V-type Immunoglobulin domain": null,
"RING-type; degenerate Zinc finger": null,
"BED-type Zinc finger": null,
"Ig-like C2-type Immunoglobulin domain": null,
"C5HC2 Zinc finger": null,
"C2H2-type 2; degenerate Zinc finger": null,
"C2H2-type 5; degenerate Zinc finger": null,
"DBF4-type Zinc finger": null,
"RING-CH-type Zinc finger": null,
"NR C4-type Zinc finger": null,
"SP-RING-type Zinc finger": null,
"RING-type Zinc finger": null,
"UBZ4-type Zinc finger": null,
"Ig-like C1-type Immunoglobulin domain": null,
"C2HC MYST-type Zinc finger": null,
"RanBP2-type Zinc finger": null,
"Ig-like Immunoglobulin domain": null,
"C3H1-type Zinc finger": null,
"C4-type Zinc finger": null,
"CCHC-type Zinc finger": null,
"RING-type; atypical Zinc finger": null,
"TFIIS-type Zinc finger": null,
"C2H2-type 2; atypical Zinc finger": null,
"RRN7-type Zinc finger": null,
"C2H2-type 1; degenerate Zinc finger": null,
"GATA-type Zinc finger": null,
" Zinc finger": null,
"Phorbol-ester/DAG-type Zinc finger": null,
"CR-type Zinc finger": null,
"GATA-type; atypical Zinc finger": null,
"PHD-type; atypical Zinc finger": null,
"C2H2-type 4; atypical Zinc finger": null,
"B box-type; degenerate Zinc finger": null,
"CCHHC-type Zinc finger": null,
"C2H2-type; atypical Zinc finger": null,
"PHD-type Zinc finger": null,
"SGF11-type Zinc finger": null,
"HIT-type Zinc finger": null,
"C2H2-type 4; degenerate Zinc finger": null,
"FYVE-type; atypical Zinc finger": null,
"FCS-type Zinc finger": null,
"RING-Gid-type Zinc finger": null,
"B box-type 1; atypical Zinc finger": null,
"B box-type Zinc finger": null,
"DNL-type Zinc finger": null,
"CCHH-type Zinc finger": null,
"ZZ-type; degenerate Zinc finger": null,
"C2H2-type 11; degenerate Zinc finger": null,
"UBZ3-type Zinc finger": null,
"PHD-type 2; atypical Zinc finger": null,
"Matrin-type Zinc finger": null,
"MYND-type Zinc finger": null,
"B box-type 2; atypical Zinc finger": null,
"C2H2-type 1; atypical Zinc finger": null,
"TAZ-type Zinc finger": null,
"CHHC U11-48K-type Zinc finger": null,
"UBZ2-type Zinc finger": null,
"C2HC pre-PHD-type Zinc finger": null,
"PHD-type; degenerate Zinc finger": null,
"C2H2-type 3; atypical Zinc finger": null,
"FYVE-type 1; atypical Zinc finger": null,
"FYVE-type Zinc finger": null,
"PARP-type Zinc finger": null,
"Btk-type Zinc finger": null,
"CCHC-type 2; atypical Zinc finger": null,
"ZZ-type Zinc finger": null,
"PHD-type 2; degenerate Zinc finger": null,
"UBP-type; degenerate Zinc finger": null,
"THAP-type Zinc finger": null,
"3CxxC-type Zinc finger": null,
"C2H2-type 6; degenerate Zinc finger": null,
"C2H2-type 7; degenerate Zinc finger": null,
"C2H2-type 9; degenerate Zinc finger": null,
"C2H2-type 6; atypical Zinc finger": null,
"RTR1-type Zinc finger": null,
"CW-type Zinc finger": null,
"FLYWCH-type Zinc finger": null,
"C2H2-type 3; degenerate Zinc finger": null,
"C3HC-type Zinc finger": null,
"CCHHC-type; degenerate Zinc finger": null,
"UBP-type Zinc finger": null,
"UBZ1-type Zinc finger": null,
"B box-type; atypical Zinc finger": null,
"FPG-type Zinc finger": null,
"Dof-type Zinc finger": null,
"ZF-HD dimerization-type; degenerate Zinc finger": null,
"NF-X1-type Zinc finger": null,
"SWIM-type Zinc finger": null,
"C2H2-type 10; degenerate Zinc finger": null,
"C2H2-type 14; degenerate Zinc finger": null,
"CXXC-type Zinc finger": null,
"TFIIB-type Zinc finger": null,
"NOB1 Zinc finger": null,
"C2H2 AKAP95-type Zinc finger": null,
"A20-type Zinc finger": null,
"AN1-type Zinc finger": null,
"MYND-type; atypical Zinc finger": null,
"RING-type 1; atypical Zinc finger": null,
"RING-type 2; atypical Zinc finger": null,
"SIAH-type Zinc finger": null,
"MYND-type; degenerate Zinc finger": null,
"C2H2-type 11; atypical Zinc finger": null
},
"bin_loc": "S",
"split": "train"
} | {
"value": "MGRFKGENRSQARWIMGGVSKGRGSGKSRKPRQAAFGQTGARVCPSSPQQDAVPRFRWPGDAECASSTHTPTMSGCKLPMGLCPDMCPAAERARRERERRLHRLEVEPGGRGNAPRADPKRTVKEYSRPAAGKPRPPPSLLRPPPVLLATVRYLAGEVAGRGDVSCAEVASFVADRLRAVRLDLSLQGVDDADAATVLEAALATLLAVVARVRPEETRGAADPVLLQTQVQEGFGSLRRCYARGKGPYPRQAAFQGLFLLYNLGSVEALQEVLQLPAALRACPPLQAALAVDAAFREDNHARLFRLLRTLPYLQSCAVQEHIGYARRKALARLSRALSTPKGQTLPLDFIEHFLALDGLQEARDLCQAHGLTLDKDRVVFLRGQYSEEGLPPPGAYHILVGNKLQGHTLEDVVMAEEGDIHRPGSAA",
"length": 427,
"molWeight": 46384,
"crc64": "99C5F943CCD935AE",
"md5": "8B0C6732F4A784A12A878B923469F62F"
} |
A6NFA1 | This is Metalloprotease TIKI2 protein, from Human, contains 517 amino acids, is membrane-bound, locates in Cell membrane. | [] | {
"primaryAccession": "A6NFA1",
"organism_name": "Human",
"protein_name": "Metalloprotease TIKI2",
"length": 517,
"firstPublicDate": "2008-09-02T00:00:00",
"FUNCTION": "Metalloprotease that acts as a negative regulator of the Wnt signaling pathway by mediating the cleavage of the 8 N-terminal residues of a subset of Wnt proteins, Following cleavage, Wnt proteins become oxidized and form large disulfide-bond oligomers, leading to their inactivation, Able to cleave WNT3A, WNT5, but not WNT11, Required for head formation",
"SUBCELLULAR LOCATION": "Cell membrane",
"SIMILARITY": "Belongs to the TIKI family",
"domain_description": {
"C2H2-type Zinc finger": null,
"C2H2-type; degenerate Zinc finger": null,
"Ig-like V-type Immunoglobulin domain": null,
"RING-type; degenerate Zinc finger": null,
"BED-type Zinc finger": null,
"Ig-like C2-type Immunoglobulin domain": null,
"C5HC2 Zinc finger": null,
"C2H2-type 2; degenerate Zinc finger": null,
"C2H2-type 5; degenerate Zinc finger": null,
"DBF4-type Zinc finger": null,
"RING-CH-type Zinc finger": null,
"NR C4-type Zinc finger": null,
"SP-RING-type Zinc finger": null,
"RING-type Zinc finger": null,
"UBZ4-type Zinc finger": null,
"Ig-like C1-type Immunoglobulin domain": null,
"C2HC MYST-type Zinc finger": null,
"RanBP2-type Zinc finger": null,
"Ig-like Immunoglobulin domain": null,
"C3H1-type Zinc finger": null,
"C4-type Zinc finger": null,
"CCHC-type Zinc finger": null,
"RING-type; atypical Zinc finger": null,
"TFIIS-type Zinc finger": null,
"C2H2-type 2; atypical Zinc finger": null,
"RRN7-type Zinc finger": null,
"C2H2-type 1; degenerate Zinc finger": null,
"GATA-type Zinc finger": null,
" Zinc finger": null,
"Phorbol-ester/DAG-type Zinc finger": null,
"CR-type Zinc finger": null,
"GATA-type; atypical Zinc finger": null,
"PHD-type; atypical Zinc finger": null,
"C2H2-type 4; atypical Zinc finger": null,
"B box-type; degenerate Zinc finger": null,
"CCHHC-type Zinc finger": null,
"C2H2-type; atypical Zinc finger": null,
"PHD-type Zinc finger": null,
"SGF11-type Zinc finger": null,
"HIT-type Zinc finger": null,
"C2H2-type 4; degenerate Zinc finger": null,
"FYVE-type; atypical Zinc finger": null,
"FCS-type Zinc finger": null,
"RING-Gid-type Zinc finger": null,
"B box-type 1; atypical Zinc finger": null,
"B box-type Zinc finger": null,
"DNL-type Zinc finger": null,
"CCHH-type Zinc finger": null,
"ZZ-type; degenerate Zinc finger": null,
"C2H2-type 11; degenerate Zinc finger": null,
"UBZ3-type Zinc finger": null,
"PHD-type 2; atypical Zinc finger": null,
"Matrin-type Zinc finger": null,
"MYND-type Zinc finger": null,
"B box-type 2; atypical Zinc finger": null,
"C2H2-type 1; atypical Zinc finger": null,
"TAZ-type Zinc finger": null,
"CHHC U11-48K-type Zinc finger": null,
"UBZ2-type Zinc finger": null,
"C2HC pre-PHD-type Zinc finger": null,
"PHD-type; degenerate Zinc finger": null,
"C2H2-type 3; atypical Zinc finger": null,
"FYVE-type 1; atypical Zinc finger": null,
"FYVE-type Zinc finger": null,
"PARP-type Zinc finger": null,
"Btk-type Zinc finger": null,
"CCHC-type 2; atypical Zinc finger": null,
"ZZ-type Zinc finger": null,
"PHD-type 2; degenerate Zinc finger": null,
"UBP-type; degenerate Zinc finger": null,
"THAP-type Zinc finger": null,
"3CxxC-type Zinc finger": null,
"C2H2-type 6; degenerate Zinc finger": null,
"C2H2-type 7; degenerate Zinc finger": null,
"C2H2-type 9; degenerate Zinc finger": null,
"C2H2-type 6; atypical Zinc finger": null,
"RTR1-type Zinc finger": null,
"CW-type Zinc finger": null,
"FLYWCH-type Zinc finger": null,
"C2H2-type 3; degenerate Zinc finger": null,
"C3HC-type Zinc finger": null,
"CCHHC-type; degenerate Zinc finger": null,
"UBP-type Zinc finger": null,
"UBZ1-type Zinc finger": null,
"B box-type; atypical Zinc finger": null,
"FPG-type Zinc finger": null,
"Dof-type Zinc finger": null,
"ZF-HD dimerization-type; degenerate Zinc finger": null,
"NF-X1-type Zinc finger": null,
"SWIM-type Zinc finger": null,
"C2H2-type 10; degenerate Zinc finger": null,
"C2H2-type 14; degenerate Zinc finger": null,
"CXXC-type Zinc finger": null,
"TFIIB-type Zinc finger": null,
"NOB1 Zinc finger": null,
"C2H2 AKAP95-type Zinc finger": null,
"A20-type Zinc finger": null,
"AN1-type Zinc finger": null,
"MYND-type; atypical Zinc finger": null,
"RING-type 1; atypical Zinc finger": null,
"RING-type 2; atypical Zinc finger": null,
"SIAH-type Zinc finger": null,
"MYND-type; degenerate Zinc finger": null,
"C2H2-type 11; atypical Zinc finger": null
},
"bin_loc": "M",
"split": "train"
} | {
"value": "MHAALAGPLLAALLATARARPQPPDGGQCRPPGSQRDLNSFLWTIRRDPPAYLFGTIHVPYTRVWDFIPDNSKAAFQASTRVYFELDLTDPYTISALASCQLLPHGENLQDVLPHELYWRLKRHLDYVKLMMPSWMTPAQRGKGLYADYLFNAIAGNWERKRPVWVMLMVNSLTERDVRFRGVPVLDLYLAQQAEKMKKTTGAVEQVEEQCHPLNNGLNFSQVLFALNQTLLQQESVRAGSLQASYTTEDLIKHYNCGDLSAVIFNHDTSQLPNFINTTLPPHEQVTAQEIDSYFRQELIYKRNERMGKRVMALLRENEDKICFFAFGAGHFLGNNTVIDILRQAGLEVDHTPAGQAIHSPAPQSPAPSPEGTSTSPAPVTPAAAVPEAPSVTPTAPPEDEDPALSPHLLLPDSLSQLEEFGRQRKWHKRQSTHQRPRQFNDLWVRIEDSTTASPPPLPLQPTHSSGTAKPPFQLSDQLQQQDPPGPASSSAPTLGLLPAIATTIAVCFLLHSLGPS",
"length": 517,
"molWeight": 57421,
"crc64": "E06AC08A4CC61840",
"md5": "7D6EB4A772CBCD057668498FFD1ADEFB"
} |
A6NK89 | This is Ras association domain-containing protein 10 protein, from Human, contains 507 amino acids, is soluble, locates in Cytoplasm. | [] | {
"primaryAccession": "A6NK89",
"organism_name": "Human",
"protein_name": "Ras association domain-containing protein 10",
"length": 507,
"firstPublicDate": "2008-04-29T00:00:00",
"FUNCTION": "Plays an important role in regulating embryonic neurogenesis",
"SUBCELLULAR LOCATION": "Cytoplasm",
"SIMILARITY": null,
"domain_description": {
"C2H2-type Zinc finger": null,
"C2H2-type; degenerate Zinc finger": null,
"Ig-like V-type Immunoglobulin domain": null,
"RING-type; degenerate Zinc finger": null,
"BED-type Zinc finger": null,
"Ig-like C2-type Immunoglobulin domain": null,
"C5HC2 Zinc finger": null,
"C2H2-type 2; degenerate Zinc finger": null,
"C2H2-type 5; degenerate Zinc finger": null,
"DBF4-type Zinc finger": null,
"RING-CH-type Zinc finger": null,
"NR C4-type Zinc finger": null,
"SP-RING-type Zinc finger": null,
"RING-type Zinc finger": null,
"UBZ4-type Zinc finger": null,
"Ig-like C1-type Immunoglobulin domain": null,
"C2HC MYST-type Zinc finger": null,
"RanBP2-type Zinc finger": null,
"Ig-like Immunoglobulin domain": null,
"C3H1-type Zinc finger": null,
"C4-type Zinc finger": null,
"CCHC-type Zinc finger": null,
"RING-type; atypical Zinc finger": null,
"TFIIS-type Zinc finger": null,
"C2H2-type 2; atypical Zinc finger": null,
"RRN7-type Zinc finger": null,
"C2H2-type 1; degenerate Zinc finger": null,
"GATA-type Zinc finger": null,
" Zinc finger": null,
"Phorbol-ester/DAG-type Zinc finger": null,
"CR-type Zinc finger": null,
"GATA-type; atypical Zinc finger": null,
"PHD-type; atypical Zinc finger": null,
"C2H2-type 4; atypical Zinc finger": null,
"B box-type; degenerate Zinc finger": null,
"CCHHC-type Zinc finger": null,
"C2H2-type; atypical Zinc finger": null,
"PHD-type Zinc finger": null,
"SGF11-type Zinc finger": null,
"HIT-type Zinc finger": null,
"C2H2-type 4; degenerate Zinc finger": null,
"FYVE-type; atypical Zinc finger": null,
"FCS-type Zinc finger": null,
"RING-Gid-type Zinc finger": null,
"B box-type 1; atypical Zinc finger": null,
"B box-type Zinc finger": null,
"DNL-type Zinc finger": null,
"CCHH-type Zinc finger": null,
"ZZ-type; degenerate Zinc finger": null,
"C2H2-type 11; degenerate Zinc finger": null,
"UBZ3-type Zinc finger": null,
"PHD-type 2; atypical Zinc finger": null,
"Matrin-type Zinc finger": null,
"MYND-type Zinc finger": null,
"B box-type 2; atypical Zinc finger": null,
"C2H2-type 1; atypical Zinc finger": null,
"TAZ-type Zinc finger": null,
"CHHC U11-48K-type Zinc finger": null,
"UBZ2-type Zinc finger": null,
"C2HC pre-PHD-type Zinc finger": null,
"PHD-type; degenerate Zinc finger": null,
"C2H2-type 3; atypical Zinc finger": null,
"FYVE-type 1; atypical Zinc finger": null,
"FYVE-type Zinc finger": null,
"PARP-type Zinc finger": null,
"Btk-type Zinc finger": null,
"CCHC-type 2; atypical Zinc finger": null,
"ZZ-type Zinc finger": null,
"PHD-type 2; degenerate Zinc finger": null,
"UBP-type; degenerate Zinc finger": null,
"THAP-type Zinc finger": null,
"3CxxC-type Zinc finger": null,
"C2H2-type 6; degenerate Zinc finger": null,
"C2H2-type 7; degenerate Zinc finger": null,
"C2H2-type 9; degenerate Zinc finger": null,
"C2H2-type 6; atypical Zinc finger": null,
"RTR1-type Zinc finger": null,
"CW-type Zinc finger": null,
"FLYWCH-type Zinc finger": null,
"C2H2-type 3; degenerate Zinc finger": null,
"C3HC-type Zinc finger": null,
"CCHHC-type; degenerate Zinc finger": null,
"UBP-type Zinc finger": null,
"UBZ1-type Zinc finger": null,
"B box-type; atypical Zinc finger": null,
"FPG-type Zinc finger": null,
"Dof-type Zinc finger": null,
"ZF-HD dimerization-type; degenerate Zinc finger": null,
"NF-X1-type Zinc finger": null,
"SWIM-type Zinc finger": null,
"C2H2-type 10; degenerate Zinc finger": null,
"C2H2-type 14; degenerate Zinc finger": null,
"CXXC-type Zinc finger": null,
"TFIIB-type Zinc finger": null,
"NOB1 Zinc finger": null,
"C2H2 AKAP95-type Zinc finger": null,
"A20-type Zinc finger": null,
"AN1-type Zinc finger": null,
"MYND-type; atypical Zinc finger": null,
"RING-type 1; atypical Zinc finger": null,
"RING-type 2; atypical Zinc finger": null,
"SIAH-type Zinc finger": null,
"MYND-type; degenerate Zinc finger": null,
"C2H2-type 11; atypical Zinc finger": null
},
"bin_loc": "S",
"split": "train"
} | {
"value": "MDPSEKKISVWICQEEKLVSGLSRRTTCSDVVRVLLEDGCRRRRRQRRSRRLGSAGDPHGPGELPEPPNEDDEDDDEALPQGMLCGPPQCYCIVEKWRGFERILPNKTRILRLWAAWGEEQENVRFVLVRSEASLPNAGPRSAEARVVLSRERPCPARGAPARPSLAMTQEKQRRVVRKAFRKLAKLNRRRQQQTPSSCSSTSSSTASSCSSSPRTHESASVERMETLVHLVLSQDHTIRQQVQRLHELDREIDHYEAKVHLDRMRRHGVNYVQDTYLVGAGIELDGSRPGEEPEEVAAEAEEAAAAPPLAGEAQAAALEELARRCDDLLRLQEQRVQQEELLERLSAEIQEELNQRWMRRRQEELAAREEPLEPDGGPDGELLLEQERVRTQLSTSLYIGLRLNTDLEAVKSDLDYSQQQWDSKKRELQGLLQTLHTLELTVAPDGAPGSGSPSREPGPQACADMWVDQARGLAKSGPGNDEDSDTGLSSMHSQDSDSLPMCESLV",
"length": 507,
"molWeight": 56900,
"crc64": "A9A5D0A546F61518",
"md5": "01D42267A83598FA833181E0184D7AAE"
} |
A6P6V9 | This is Cannabidiolic acid synthase protein, from Hemp, contains 544 amino acids, is soluble, locates in Extracellular. | [] | {
"primaryAccession": "A6P6V9",
"organism_name": "Hemp",
"protein_name": "Cannabidiolic acid synthase",
"length": 544,
"firstPublicDate": "2013-02-06T00:00:00",
"FUNCTION": "Oxidoreductase involved in the biosynthesis of cannabinoids-related terpenophenolic natural products, which have pharmacological activity (PubMed:17544411, PubMed:8663284), Catalyzes the stereoselective oxidative cyclization of the monoterpene moiety in cannabigerolic acid (CBGA), producing cannabidiolate (CBDA), the major cannabioid in fiber-type Cannabis plants (PubMed:17544411, PubMed:8663284), Can also use cannabinerolic acid as substrate, but not cannabigerol or cannabinerol (PubMed:17544411, PubMed:8663284)",
"SUBCELLULAR LOCATION": "Extracellular",
"SIMILARITY": "Belongs to the oxygen-dependent FAD-linked oxidoreductase family",
"domain_description": {
"C2H2-type Zinc finger": null,
"C2H2-type; degenerate Zinc finger": null,
"Ig-like V-type Immunoglobulin domain": null,
"RING-type; degenerate Zinc finger": null,
"BED-type Zinc finger": null,
"Ig-like C2-type Immunoglobulin domain": null,
"C5HC2 Zinc finger": null,
"C2H2-type 2; degenerate Zinc finger": null,
"C2H2-type 5; degenerate Zinc finger": null,
"DBF4-type Zinc finger": null,
"RING-CH-type Zinc finger": null,
"NR C4-type Zinc finger": null,
"SP-RING-type Zinc finger": null,
"RING-type Zinc finger": null,
"UBZ4-type Zinc finger": null,
"Ig-like C1-type Immunoglobulin domain": null,
"C2HC MYST-type Zinc finger": null,
"RanBP2-type Zinc finger": null,
"Ig-like Immunoglobulin domain": null,
"C3H1-type Zinc finger": null,
"C4-type Zinc finger": null,
"CCHC-type Zinc finger": null,
"RING-type; atypical Zinc finger": null,
"TFIIS-type Zinc finger": null,
"C2H2-type 2; atypical Zinc finger": null,
"RRN7-type Zinc finger": null,
"C2H2-type 1; degenerate Zinc finger": null,
"GATA-type Zinc finger": null,
" Zinc finger": null,
"Phorbol-ester/DAG-type Zinc finger": null,
"CR-type Zinc finger": null,
"GATA-type; atypical Zinc finger": null,
"PHD-type; atypical Zinc finger": null,
"C2H2-type 4; atypical Zinc finger": null,
"B box-type; degenerate Zinc finger": null,
"CCHHC-type Zinc finger": null,
"C2H2-type; atypical Zinc finger": null,
"PHD-type Zinc finger": null,
"SGF11-type Zinc finger": null,
"HIT-type Zinc finger": null,
"C2H2-type 4; degenerate Zinc finger": null,
"FYVE-type; atypical Zinc finger": null,
"FCS-type Zinc finger": null,
"RING-Gid-type Zinc finger": null,
"B box-type 1; atypical Zinc finger": null,
"B box-type Zinc finger": null,
"DNL-type Zinc finger": null,
"CCHH-type Zinc finger": null,
"ZZ-type; degenerate Zinc finger": null,
"C2H2-type 11; degenerate Zinc finger": null,
"UBZ3-type Zinc finger": null,
"PHD-type 2; atypical Zinc finger": null,
"Matrin-type Zinc finger": null,
"MYND-type Zinc finger": null,
"B box-type 2; atypical Zinc finger": null,
"C2H2-type 1; atypical Zinc finger": null,
"TAZ-type Zinc finger": null,
"CHHC U11-48K-type Zinc finger": null,
"UBZ2-type Zinc finger": null,
"C2HC pre-PHD-type Zinc finger": null,
"PHD-type; degenerate Zinc finger": null,
"C2H2-type 3; atypical Zinc finger": null,
"FYVE-type 1; atypical Zinc finger": null,
"FYVE-type Zinc finger": null,
"PARP-type Zinc finger": null,
"Btk-type Zinc finger": null,
"CCHC-type 2; atypical Zinc finger": null,
"ZZ-type Zinc finger": null,
"PHD-type 2; degenerate Zinc finger": null,
"UBP-type; degenerate Zinc finger": null,
"THAP-type Zinc finger": null,
"3CxxC-type Zinc finger": null,
"C2H2-type 6; degenerate Zinc finger": null,
"C2H2-type 7; degenerate Zinc finger": null,
"C2H2-type 9; degenerate Zinc finger": null,
"C2H2-type 6; atypical Zinc finger": null,
"RTR1-type Zinc finger": null,
"CW-type Zinc finger": null,
"FLYWCH-type Zinc finger": null,
"C2H2-type 3; degenerate Zinc finger": null,
"C3HC-type Zinc finger": null,
"CCHHC-type; degenerate Zinc finger": null,
"UBP-type Zinc finger": null,
"UBZ1-type Zinc finger": null,
"B box-type; atypical Zinc finger": null,
"FPG-type Zinc finger": null,
"Dof-type Zinc finger": null,
"ZF-HD dimerization-type; degenerate Zinc finger": null,
"NF-X1-type Zinc finger": null,
"SWIM-type Zinc finger": null,
"C2H2-type 10; degenerate Zinc finger": null,
"C2H2-type 14; degenerate Zinc finger": null,
"CXXC-type Zinc finger": null,
"TFIIB-type Zinc finger": null,
"NOB1 Zinc finger": null,
"C2H2 AKAP95-type Zinc finger": null,
"A20-type Zinc finger": null,
"AN1-type Zinc finger": null,
"MYND-type; atypical Zinc finger": null,
"RING-type 1; atypical Zinc finger": null,
"RING-type 2; atypical Zinc finger": null,
"SIAH-type Zinc finger": null,
"MYND-type; degenerate Zinc finger": null,
"C2H2-type 11; atypical Zinc finger": null
},
"bin_loc": "S",
"split": "train"
} | {
"value": "MKCSTFSFWFVCKIIFFFFSFNIQTSIANPRENFLKCFSQYIPNNATNLKLVYTQNNPLYMSVLNSTIHNLRFTSDTTPKPLVIVTPSHVSHIQGTILCSKKVGLQIRTRSGGHDSEGMSYISQVPFVIVDLRNMRSIKIDVHSQTAWVEAGATLGEVYYWVNEKNENLSLAAGYCPTVCAGGHFGGGGYGPLMRNYGLAADNIIDAHLVNVHGKVLDRKSMGEDLFWALRGGGAESFGIIVAWKIRLVAVPKSTMFSVKKIMEIHELVKLVNKWQNIAYKYDKDLLLMTHFITRNITDNQGKNKTAIHTYFSSVFLGGVDSLVDLMNKSFPELGIKKTDCRQLSWIDTIIFYSGVVNYDTDNFNKEILLDRSAGQNGAFKIKLDYVKKPIPESVFVQILEKLYEEDIGAGMYALYPYGGIMDEISESAIPFPHRAGILYELWYICSWEKQEDNEKHLNWIRNIYNFMTPYVSKNPRLAYLNYRDLDIGINDPKNPNNYTQARIWGEKYFGKNFDRLVKVKTLVDPNNFFRNEQSIPPLPRHRH",
"length": 544,
"molWeight": 62237,
"crc64": "199378287274F156",
"md5": "0B50045FA507A4B173DEB42A5C645291"
} |
End of preview.
No dataset card yet
- Downloads last month
- 43